Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)

Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients...
Ausführliche Beschreibung

Gespeichert in:

Autor*in:	Savić Nenad [verfasserIn] Golubović Ilija [verfasserIn] Stojanović Milena [verfasserIn] Vuković Anita [verfasserIn] Marković Danica [verfasserIn] Janković Radmilo [verfasserIn]

Format:	E-Artikel
Sprache:	Englisch ; srp

Erschienen:	2018

Schlagwörter:	cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease

Übergeordnetes Werk:	In: Serbian Journal of Anesthesia and Intensive Therapy - Serbian Society of Anesthesiologists and Intensivists, 2017, 40(2018), 7-8, Seite 163-170
Übergeordnetes Werk:	volume:40 ; year:2018 ; number:7-8 ; pages:163-170

Links:	Link aufrufen Link aufrufen Journal toc Journal toc

Katalog-ID:	DOAJ024533599

Internformat


LEADER	01000caa a22002652 4500
001	DOAJ024533599
003	DE-627
005	20230307075017.0
007	cr uuu---uuuuu
008	230226s2018 xx \|\|\|\|\|o 00\| \|\|eng c
035			\|a (DE-627)DOAJ024533599
035			\|a (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc
040			\|a DE-627 \|b ger \|c DE-627 \|e rakwb
041			\|a eng \|a srp
050		0	\|a RD78.3-87.3
100	0		\|a Savić Nenad \|e verfasserin \|4 aut
245	1	0	\|a Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)
264		1	\|c 2018
336			\|a Text \|b txt \|2 rdacontent
337			\|a Computermedien \|b c \|2 rdamedia
338			\|a Online-Ressource \|b cr \|2 rdacarrier
520			\|a Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery.
650		4	\|a cardiac biomarkers
650		4	\|a short-term mortality
650		4	\|a perioperative risk
650		4	\|a non-cardiac surgery
650		4	\|a coronary artery disease
653		0	\|a Anesthesiology
700	0		\|a Golubović Ilija \|e verfasserin \|4 aut
700	0		\|a Stojanović Milena \|e verfasserin \|4 aut
700	0		\|a Vuković Anita \|e verfasserin \|4 aut
700	0		\|a Marković Danica \|e verfasserin \|4 aut
700	0		\|a Janković Radmilo \|e verfasserin \|4 aut
773	0	8	\|i In \|t Serbian Journal of Anesthesia and Intensive Therapy \|d Serbian Society of Anesthesiologists and Intensivists, 2017 \|g 40(2018), 7-8, Seite 163-170 \|w (DE-627)1760609781 \|x 2466488X \|7 nnns
773	1	8	\|g volume:40 \|g year:2018 \|g number:7-8 \|g pages:163-170
856	4	0	\|u https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc \|z kostenfrei
856	4	0	\|u https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf \|z kostenfrei
856	4	2	\|u https://doaj.org/toc/2466-488X \|y Journal toc \|z kostenfrei
856	4	2	\|u https://doaj.org/toc/2466-488X \|y Journal toc \|z kostenfrei
912			\|a GBV_USEFLAG_A
912			\|a SYSFLAG_A
912			\|a GBV_DOAJ
951			\|a AR
952			\|d 40 \|j 2018 \|e 7-8 \|h 163-170

Indexfelder

author_variant	s n sn g i gi s m sm v a va m d md j r jr
matchkey_str	article:2466488X:2018----::roeaieihestvtooitnnemnlrbyearueippienrdcinfhrtrmraiyfennadasreyihestvtooitnnemnlrbyea
hierarchy_sort_str	2018
callnumber-subject-code	RD
publishDate	2018
allfields	(DE-627)DOAJ024533599 (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc DE-627 ger DE-627 rakwb eng srp RD78.3-87.3 Savić Nenad verfasserin aut Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) 2018 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease Anesthesiology Golubović Ilija verfasserin aut Stojanović Milena verfasserin aut Vuković Anita verfasserin aut Marković Danica verfasserin aut Janković Radmilo verfasserin aut In Serbian Journal of Anesthesia and Intensive Therapy Serbian Society of Anesthesiologists and Intensivists, 2017 40(2018), 7-8, Seite 163-170 (DE-627)1760609781 2466488X nnns volume:40 year:2018 number:7-8 pages:163-170 https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc kostenfrei https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 40 2018 7-8 163-170
spelling	(DE-627)DOAJ024533599 (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc DE-627 ger DE-627 rakwb eng srp RD78.3-87.3 Savić Nenad verfasserin aut Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) 2018 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease Anesthesiology Golubović Ilija verfasserin aut Stojanović Milena verfasserin aut Vuković Anita verfasserin aut Marković Danica verfasserin aut Janković Radmilo verfasserin aut In Serbian Journal of Anesthesia and Intensive Therapy Serbian Society of Anesthesiologists and Intensivists, 2017 40(2018), 7-8, Seite 163-170 (DE-627)1760609781 2466488X nnns volume:40 year:2018 number:7-8 pages:163-170 https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc kostenfrei https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 40 2018 7-8 163-170
allfields_unstemmed	(DE-627)DOAJ024533599 (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc DE-627 ger DE-627 rakwb eng srp RD78.3-87.3 Savić Nenad verfasserin aut Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) 2018 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease Anesthesiology Golubović Ilija verfasserin aut Stojanović Milena verfasserin aut Vuković Anita verfasserin aut Marković Danica verfasserin aut Janković Radmilo verfasserin aut In Serbian Journal of Anesthesia and Intensive Therapy Serbian Society of Anesthesiologists and Intensivists, 2017 40(2018), 7-8, Seite 163-170 (DE-627)1760609781 2466488X nnns volume:40 year:2018 number:7-8 pages:163-170 https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc kostenfrei https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 40 2018 7-8 163-170
allfieldsGer	(DE-627)DOAJ024533599 (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc DE-627 ger DE-627 rakwb eng srp RD78.3-87.3 Savić Nenad verfasserin aut Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) 2018 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease Anesthesiology Golubović Ilija verfasserin aut Stojanović Milena verfasserin aut Vuković Anita verfasserin aut Marković Danica verfasserin aut Janković Radmilo verfasserin aut In Serbian Journal of Anesthesia and Intensive Therapy Serbian Society of Anesthesiologists and Intensivists, 2017 40(2018), 7-8, Seite 163-170 (DE-627)1760609781 2466488X nnns volume:40 year:2018 number:7-8 pages:163-170 https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc kostenfrei https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 40 2018 7-8 163-170
allfieldsSound	(DE-627)DOAJ024533599 (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc DE-627 ger DE-627 rakwb eng srp RD78.3-87.3 Savić Nenad verfasserin aut Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) 2018 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease Anesthesiology Golubović Ilija verfasserin aut Stojanović Milena verfasserin aut Vuković Anita verfasserin aut Marković Danica verfasserin aut Janković Radmilo verfasserin aut In Serbian Journal of Anesthesia and Intensive Therapy Serbian Society of Anesthesiologists and Intensivists, 2017 40(2018), 7-8, Seite 163-170 (DE-627)1760609781 2466488X nnns volume:40 year:2018 number:7-8 pages:163-170 https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc kostenfrei https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 40 2018 7-8 163-170
language	English
source	In Serbian Journal of Anesthesia and Intensive Therapy 40(2018), 7-8, Seite 163-170 volume:40 year:2018 number:7-8 pages:163-170
sourceStr	In Serbian Journal of Anesthesia and Intensive Therapy 40(2018), 7-8, Seite 163-170 volume:40 year:2018 number:7-8 pages:163-170
format_phy_str_mv	Article
institution	findex.gbv.de
topic_facet	cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease Anesthesiology
isfreeaccess_bool	true
container_title	Serbian Journal of Anesthesia and Intensive Therapy
authorswithroles_txt_mv	Savić Nenad @@aut@@ Golubović Ilija @@aut@@ Stojanović Milena @@aut@@ Vuković Anita @@aut@@ Marković Danica @@aut@@ Janković Radmilo @@aut@@
publishDateDaySort_date	2018-01-01T00:00:00Z
hierarchy_top_id	1760609781
id	DOAJ024533599
language_de	englisch
fullrecord	<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">DOAJ024533599</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230307075017.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">230226s2018 xx \|\|\|\|\|o 00\| \|\|eng c</controlfield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)DOAJ024533599</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield><subfield code="a">srp</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">RD78.3-87.3</subfield></datafield><datafield tag="100" ind1="0" ind2=" "><subfield code="a">Savić Nenad</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2018</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">Text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">Computermedien</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">Online-Ressource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery.</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">cardiac biomarkers</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">short-term mortality</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">perioperative risk</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">non-cardiac surgery</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">coronary artery disease</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Anesthesiology</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Golubović Ilija</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Stojanović Milena</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Vuković Anita</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Marković Danica</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Janković Radmilo</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">In</subfield><subfield code="t">Serbian Journal of Anesthesia and Intensive Therapy</subfield><subfield code="d">Serbian Society of Anesthesiologists and Intensivists, 2017</subfield><subfield code="g">40(2018), 7-8, Seite 163-170</subfield><subfield code="w">(DE-627)1760609781</subfield><subfield code="x">2466488X</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:40</subfield><subfield code="g">year:2018</subfield><subfield code="g">number:7-8</subfield><subfield code="g">pages:163-170</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/2466-488X</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/2466-488X</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_DOAJ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">40</subfield><subfield code="j">2018</subfield><subfield code="e">7-8</subfield><subfield code="h">163-170</subfield></datafield></record></collection>
callnumber-first	R - Medicine
author	Savić Nenad
spellingShingle	Savić Nenad misc RD78.3-87.3 misc cardiac biomarkers misc short-term mortality misc perioperative risk misc non-cardiac surgery misc coronary artery disease misc Anesthesiology Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)
authorStr	Savić Nenad
ppnlink_with_tag_str_mv	@@773@@(DE-627)1760609781
format	electronic Article
delete_txt_mv	keep
author_role	aut aut aut aut aut aut
collection	DOAJ
remote_str	true
callnumber-label	RD78
illustrated	Not Illustrated
issn	2466488X
topic_title	RD78.3-87.3 Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease
topic	misc RD78.3-87.3 misc cardiac biomarkers misc short-term mortality misc perioperative risk misc non-cardiac surgery misc coronary artery disease misc Anesthesiology
topic_unstemmed	misc RD78.3-87.3 misc cardiac biomarkers misc short-term mortality misc perioperative risk misc non-cardiac surgery misc coronary artery disease misc Anesthesiology
topic_browse	misc RD78.3-87.3 misc cardiac biomarkers misc short-term mortality misc perioperative risk misc non-cardiac surgery misc coronary artery disease misc Anesthesiology
format_facet	Elektronische Aufsätze Aufsätze Elektronische Ressource
format_main_str_mv	Text Zeitschrift/Artikel
carriertype_str_mv	cr
hierarchy_parent_title	Serbian Journal of Anesthesia and Intensive Therapy
hierarchy_parent_id	1760609781
hierarchy_top_title	Serbian Journal of Anesthesia and Intensive Therapy
isfreeaccess_txt	true
familylinks_str_mv	(DE-627)1760609781
title	Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)
ctrlnum	(DE-627)DOAJ024533599 (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc
title_full	Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)
author_sort	Savić Nenad
journal	Serbian Journal of Anesthesia and Intensive Therapy
journalStr	Serbian Journal of Anesthesia and Intensive Therapy
callnumber-first-code	R
lang_code	eng srp
isOA_bool	true
recordtype	marc
publishDateSort	2018
contenttype_str_mv	txt
container_start_page	163
author_browse	Savić Nenad Golubović Ilija Stojanović Milena Vuković Anita Marković Danica Janković Radmilo
container_volume	40
class	RD78.3-87.3
format_se	Elektronische Aufsätze
author-letter	Savić Nenad
author2-role	verfasserin
title_sort	preoperative high-sensitive troponin t and n-terminal pro b-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (high-sensitive troponin t and n-terminal pro b-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)
callnumber	RD78.3-87.3
title_auth	Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)
abstract	Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery.
abstractGer	Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery.
abstract_unstemmed	Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery.
collection_details	GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ
container_issue	7-8
title_short	Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)
url	https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf https://doaj.org/toc/2466-488X
remote_bool	true
author2	Golubović Ilija Stojanović Milena Vuković Anita Marković Danica Janković Radmilo
author2Str	Golubović Ilija Stojanović Milena Vuković Anita Marković Danica Janković Radmilo
ppnlink	1760609781
callnumber-subject	RD - Surgery
mediatype_str_mv	c
isOA_txt	true
hochschulschrift_bool	false
callnumber-a	RD78.3-87.3
up_date	2024-07-03T23:22:08.766Z
_version_	1803602025534980096
fullrecord_marcxml	<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">DOAJ024533599</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230307075017.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">230226s2018 xx \|\|\|\|\|o 00\| \|\|eng c</controlfield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)DOAJ024533599</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield><subfield code="a">srp</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">RD78.3-87.3</subfield></datafield><datafield tag="100" ind1="0" ind2=" "><subfield code="a">Savić Nenad</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2018</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">Text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">Computermedien</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">Online-Ressource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery.</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">cardiac biomarkers</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">short-term mortality</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">perioperative risk</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">non-cardiac surgery</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">coronary artery disease</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Anesthesiology</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Golubović Ilija</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Stojanović Milena</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Vuković Anita</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Marković Danica</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Janković Radmilo</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">In</subfield><subfield code="t">Serbian Journal of Anesthesia and Intensive Therapy</subfield><subfield code="d">Serbian Society of Anesthesiologists and Intensivists, 2017</subfield><subfield code="g">40(2018), 7-8, Seite 163-170</subfield><subfield code="w">(DE-627)1760609781</subfield><subfield code="x">2466488X</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:40</subfield><subfield code="g">year:2018</subfield><subfield code="g">number:7-8</subfield><subfield code="g">pages:163-170</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/2466-488X</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/2466-488X</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_DOAJ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">40</subfield><subfield code="j">2018</subfield><subfield code="e">7-8</subfield><subfield code="h">163-170</subfield></datafield></record></collection>
score	7.400819

Nicht das Richtige dabei?

Schreiben Sie uns!

Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)

Nicht das Richtige dabei?

Zugang & Verfügbarkeit

Vorhandene Bände

Nicht das Richtige dabei?