Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)
Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients...
Ausführliche Beschreibung
Autor*in: |
Savić Nenad [verfasserIn] Golubović Ilija [verfasserIn] Stojanović Milena [verfasserIn] Vuković Anita [verfasserIn] Marković Danica [verfasserIn] Janković Radmilo [verfasserIn] |
---|
Format: |
E-Artikel |
---|---|
Sprache: |
Englisch ; srp |
Erschienen: |
2018 |
---|
Schlagwörter: |
---|
Übergeordnetes Werk: |
In: Serbian Journal of Anesthesia and Intensive Therapy - Serbian Society of Anesthesiologists and Intensivists, 2017, 40(2018), 7-8, Seite 163-170 |
---|---|
Übergeordnetes Werk: |
volume:40 ; year:2018 ; number:7-8 ; pages:163-170 |
Links: |
---|
Katalog-ID: |
DOAJ024533599 |
---|
LEADER | 01000caa a22002652 4500 | ||
---|---|---|---|
001 | DOAJ024533599 | ||
003 | DE-627 | ||
005 | 20230307075017.0 | ||
007 | cr uuu---uuuuu | ||
008 | 230226s2018 xx |||||o 00| ||eng c | ||
035 | |a (DE-627)DOAJ024533599 | ||
035 | |a (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc | ||
040 | |a DE-627 |b ger |c DE-627 |e rakwb | ||
041 | |a eng |a srp | ||
050 | 0 | |a RD78.3-87.3 | |
100 | 0 | |a Savić Nenad |e verfasserin |4 aut | |
245 | 1 | 0 | |a Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) |
264 | 1 | |c 2018 | |
336 | |a Text |b txt |2 rdacontent | ||
337 | |a Computermedien |b c |2 rdamedia | ||
338 | |a Online-Ressource |b cr |2 rdacarrier | ||
520 | |a Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. | ||
650 | 4 | |a cardiac biomarkers | |
650 | 4 | |a short-term mortality | |
650 | 4 | |a perioperative risk | |
650 | 4 | |a non-cardiac surgery | |
650 | 4 | |a coronary artery disease | |
653 | 0 | |a Anesthesiology | |
700 | 0 | |a Golubović Ilija |e verfasserin |4 aut | |
700 | 0 | |a Stojanović Milena |e verfasserin |4 aut | |
700 | 0 | |a Vuković Anita |e verfasserin |4 aut | |
700 | 0 | |a Marković Danica |e verfasserin |4 aut | |
700 | 0 | |a Janković Radmilo |e verfasserin |4 aut | |
773 | 0 | 8 | |i In |t Serbian Journal of Anesthesia and Intensive Therapy |d Serbian Society of Anesthesiologists and Intensivists, 2017 |g 40(2018), 7-8, Seite 163-170 |w (DE-627)1760609781 |x 2466488X |7 nnns |
773 | 1 | 8 | |g volume:40 |g year:2018 |g number:7-8 |g pages:163-170 |
856 | 4 | 0 | |u https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc |z kostenfrei |
856 | 4 | 0 | |u https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf |z kostenfrei |
856 | 4 | 2 | |u https://doaj.org/toc/2466-488X |y Journal toc |z kostenfrei |
856 | 4 | 2 | |u https://doaj.org/toc/2466-488X |y Journal toc |z kostenfrei |
912 | |a GBV_USEFLAG_A | ||
912 | |a SYSFLAG_A | ||
912 | |a GBV_DOAJ | ||
951 | |a AR | ||
952 | |d 40 |j 2018 |e 7-8 |h 163-170 |
author_variant |
s n sn g i gi s m sm v a va m d md j r jr |
---|---|
matchkey_str |
article:2466488X:2018----::roeaieihestvtooitnnemnlrbyearueippienrdcinfhrtrmraiyfennadasreyihestvtooitnnemnlrbyea |
hierarchy_sort_str |
2018 |
callnumber-subject-code |
RD |
publishDate |
2018 |
allfields |
(DE-627)DOAJ024533599 (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc DE-627 ger DE-627 rakwb eng srp RD78.3-87.3 Savić Nenad verfasserin aut Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) 2018 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease Anesthesiology Golubović Ilija verfasserin aut Stojanović Milena verfasserin aut Vuković Anita verfasserin aut Marković Danica verfasserin aut Janković Radmilo verfasserin aut In Serbian Journal of Anesthesia and Intensive Therapy Serbian Society of Anesthesiologists and Intensivists, 2017 40(2018), 7-8, Seite 163-170 (DE-627)1760609781 2466488X nnns volume:40 year:2018 number:7-8 pages:163-170 https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc kostenfrei https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 40 2018 7-8 163-170 |
spelling |
(DE-627)DOAJ024533599 (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc DE-627 ger DE-627 rakwb eng srp RD78.3-87.3 Savić Nenad verfasserin aut Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) 2018 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease Anesthesiology Golubović Ilija verfasserin aut Stojanović Milena verfasserin aut Vuković Anita verfasserin aut Marković Danica verfasserin aut Janković Radmilo verfasserin aut In Serbian Journal of Anesthesia and Intensive Therapy Serbian Society of Anesthesiologists and Intensivists, 2017 40(2018), 7-8, Seite 163-170 (DE-627)1760609781 2466488X nnns volume:40 year:2018 number:7-8 pages:163-170 https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc kostenfrei https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 40 2018 7-8 163-170 |
allfields_unstemmed |
(DE-627)DOAJ024533599 (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc DE-627 ger DE-627 rakwb eng srp RD78.3-87.3 Savić Nenad verfasserin aut Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) 2018 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease Anesthesiology Golubović Ilija verfasserin aut Stojanović Milena verfasserin aut Vuković Anita verfasserin aut Marković Danica verfasserin aut Janković Radmilo verfasserin aut In Serbian Journal of Anesthesia and Intensive Therapy Serbian Society of Anesthesiologists and Intensivists, 2017 40(2018), 7-8, Seite 163-170 (DE-627)1760609781 2466488X nnns volume:40 year:2018 number:7-8 pages:163-170 https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc kostenfrei https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 40 2018 7-8 163-170 |
allfieldsGer |
(DE-627)DOAJ024533599 (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc DE-627 ger DE-627 rakwb eng srp RD78.3-87.3 Savić Nenad verfasserin aut Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) 2018 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease Anesthesiology Golubović Ilija verfasserin aut Stojanović Milena verfasserin aut Vuković Anita verfasserin aut Marković Danica verfasserin aut Janković Radmilo verfasserin aut In Serbian Journal of Anesthesia and Intensive Therapy Serbian Society of Anesthesiologists and Intensivists, 2017 40(2018), 7-8, Seite 163-170 (DE-627)1760609781 2466488X nnns volume:40 year:2018 number:7-8 pages:163-170 https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc kostenfrei https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 40 2018 7-8 163-170 |
allfieldsSound |
(DE-627)DOAJ024533599 (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc DE-627 ger DE-627 rakwb eng srp RD78.3-87.3 Savić Nenad verfasserin aut Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) 2018 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease Anesthesiology Golubović Ilija verfasserin aut Stojanović Milena verfasserin aut Vuković Anita verfasserin aut Marković Danica verfasserin aut Janković Radmilo verfasserin aut In Serbian Journal of Anesthesia and Intensive Therapy Serbian Society of Anesthesiologists and Intensivists, 2017 40(2018), 7-8, Seite 163-170 (DE-627)1760609781 2466488X nnns volume:40 year:2018 number:7-8 pages:163-170 https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc kostenfrei https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei https://doaj.org/toc/2466-488X Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 40 2018 7-8 163-170 |
language |
English |
source |
In Serbian Journal of Anesthesia and Intensive Therapy 40(2018), 7-8, Seite 163-170 volume:40 year:2018 number:7-8 pages:163-170 |
sourceStr |
In Serbian Journal of Anesthesia and Intensive Therapy 40(2018), 7-8, Seite 163-170 volume:40 year:2018 number:7-8 pages:163-170 |
format_phy_str_mv |
Article |
institution |
findex.gbv.de |
topic_facet |
cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease Anesthesiology |
isfreeaccess_bool |
true |
container_title |
Serbian Journal of Anesthesia and Intensive Therapy |
authorswithroles_txt_mv |
Savić Nenad @@aut@@ Golubović Ilija @@aut@@ Stojanović Milena @@aut@@ Vuković Anita @@aut@@ Marković Danica @@aut@@ Janković Radmilo @@aut@@ |
publishDateDaySort_date |
2018-01-01T00:00:00Z |
hierarchy_top_id |
1760609781 |
id |
DOAJ024533599 |
language_de |
englisch |
fullrecord |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">DOAJ024533599</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230307075017.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">230226s2018 xx |||||o 00| ||eng c</controlfield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)DOAJ024533599</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield><subfield code="a">srp</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">RD78.3-87.3</subfield></datafield><datafield tag="100" ind1="0" ind2=" "><subfield code="a">Savić Nenad</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2018</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">Text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">Computermedien</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">Online-Ressource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery.</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">cardiac biomarkers</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">short-term mortality</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">perioperative risk</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">non-cardiac surgery</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">coronary artery disease</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Anesthesiology</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Golubović Ilija</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Stojanović Milena</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Vuković Anita</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Marković Danica</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Janković Radmilo</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">In</subfield><subfield code="t">Serbian Journal of Anesthesia and Intensive Therapy</subfield><subfield code="d">Serbian Society of Anesthesiologists and Intensivists, 2017</subfield><subfield code="g">40(2018), 7-8, Seite 163-170</subfield><subfield code="w">(DE-627)1760609781</subfield><subfield code="x">2466488X</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:40</subfield><subfield code="g">year:2018</subfield><subfield code="g">number:7-8</subfield><subfield code="g">pages:163-170</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/2466-488X</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/2466-488X</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_DOAJ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">40</subfield><subfield code="j">2018</subfield><subfield code="e">7-8</subfield><subfield code="h">163-170</subfield></datafield></record></collection>
|
callnumber-first |
R - Medicine |
author |
Savić Nenad |
spellingShingle |
Savić Nenad misc RD78.3-87.3 misc cardiac biomarkers misc short-term mortality misc perioperative risk misc non-cardiac surgery misc coronary artery disease misc Anesthesiology Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) |
authorStr |
Savić Nenad |
ppnlink_with_tag_str_mv |
@@773@@(DE-627)1760609781 |
format |
electronic Article |
delete_txt_mv |
keep |
author_role |
aut aut aut aut aut aut |
collection |
DOAJ |
remote_str |
true |
callnumber-label |
RD78 |
illustrated |
Not Illustrated |
issn |
2466488X |
topic_title |
RD78.3-87.3 Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) cardiac biomarkers short-term mortality perioperative risk non-cardiac surgery coronary artery disease |
topic |
misc RD78.3-87.3 misc cardiac biomarkers misc short-term mortality misc perioperative risk misc non-cardiac surgery misc coronary artery disease misc Anesthesiology |
topic_unstemmed |
misc RD78.3-87.3 misc cardiac biomarkers misc short-term mortality misc perioperative risk misc non-cardiac surgery misc coronary artery disease misc Anesthesiology |
topic_browse |
misc RD78.3-87.3 misc cardiac biomarkers misc short-term mortality misc perioperative risk misc non-cardiac surgery misc coronary artery disease misc Anesthesiology |
format_facet |
Elektronische Aufsätze Aufsätze Elektronische Ressource |
format_main_str_mv |
Text Zeitschrift/Artikel |
carriertype_str_mv |
cr |
hierarchy_parent_title |
Serbian Journal of Anesthesia and Intensive Therapy |
hierarchy_parent_id |
1760609781 |
hierarchy_top_title |
Serbian Journal of Anesthesia and Intensive Therapy |
isfreeaccess_txt |
true |
familylinks_str_mv |
(DE-627)1760609781 |
title |
Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) |
ctrlnum |
(DE-627)DOAJ024533599 (DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc |
title_full |
Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) |
author_sort |
Savić Nenad |
journal |
Serbian Journal of Anesthesia and Intensive Therapy |
journalStr |
Serbian Journal of Anesthesia and Intensive Therapy |
callnumber-first-code |
R |
lang_code |
eng srp |
isOA_bool |
true |
recordtype |
marc |
publishDateSort |
2018 |
contenttype_str_mv |
txt |
container_start_page |
163 |
author_browse |
Savić Nenad Golubović Ilija Stojanović Milena Vuković Anita Marković Danica Janković Radmilo |
container_volume |
40 |
class |
RD78.3-87.3 |
format_se |
Elektronische Aufsätze |
author-letter |
Savić Nenad |
author2-role |
verfasserin |
title_sort |
preoperative high-sensitive troponin t and n-terminal pro b-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (high-sensitive troponin t and n-terminal pro b-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) |
callnumber |
RD78.3-87.3 |
title_auth |
Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) |
abstract |
Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. |
abstractGer |
Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. |
abstract_unstemmed |
Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery. |
collection_details |
GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ |
container_issue |
7-8 |
title_short |
Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery) |
url |
https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf https://doaj.org/toc/2466-488X |
remote_bool |
true |
author2 |
Golubović Ilija Stojanović Milena Vuković Anita Marković Danica Janković Radmilo |
author2Str |
Golubović Ilija Stojanović Milena Vuković Anita Marković Danica Janković Radmilo |
ppnlink |
1760609781 |
callnumber-subject |
RD - Surgery |
mediatype_str_mv |
c |
isOA_txt |
true |
hochschulschrift_bool |
false |
callnumber-a |
RD78.3-87.3 |
up_date |
2024-07-03T23:22:08.766Z |
_version_ |
1803602025534980096 |
fullrecord_marcxml |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">DOAJ024533599</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230307075017.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">230226s2018 xx |||||o 00| ||eng c</controlfield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)DOAJ024533599</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)DOAJ179e6a163dad44a2982565fa674ea0cc</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield><subfield code="a">srp</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">RD78.3-87.3</subfield></datafield><datafield tag="100" ind1="0" ind2=" "><subfield code="a">Savić Nenad</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Preoperative high-sensitive troponin T and N-terminal pro B-type natriuretic peptide in prediction of short-term mortality after non-cardiac surgery (High-sensitive troponin T and N-terminal pro B-type natriuretuc peptide in prediciton of mortality after non-cardiac surgery)</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2018</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">Text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">Computermedien</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">Online-Ressource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Background and Aims: The aim of this study was to evaluate potential of prognostic cardiac biomarkers by predicting fatal events during perioperative period and the significance of their increased values in all patients and with coronary artery disease (CAD). Methods: The study included 87 patients who underwent major abdominal and vascular surgery. Blood samples were taken from all patients prior to surgery and levels of high-sensitive troponin T (hsTnT) and N-Terminal Pro B-type natriuretic peptide (NT-proBNP) were measured. It was analyzed how their increased values (above the predefined cut-offs of < 14 ng/L and < 300 pg/mL respectively) was associated with perioperative mortality in both all subjects and in patients with CAD. Results: Median value of hsTnT in survival group was 11.29 ng/L (interquartile range - IQR, 6.03-18.57) vs. 26.62 ng/L (IQR, 21.48-76.31) in non-survival group, p = 0.045 and for NT-proBNP in survival group was 259.05 pg/mL (IQR, 93.03-447.45) vs. 759.2 pg/mL (IQR, 433-6095) in non-survival group, p = 0.017. The odds ratio of mortality was presented in the form of direct association for both measured biomarkers - not only in patients with CAD but also in all included patients. Conclusions: Preoperatively increased hsTnT and NT-proBNP indicate high mortality risk during perioperative period. Because of the association between increased cardiac biomarker and mortality events in patients with CAD, special attention is necessary in preparation for major surgery.</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">cardiac biomarkers</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">short-term mortality</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">perioperative risk</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">non-cardiac surgery</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">coronary artery disease</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Anesthesiology</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Golubović Ilija</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Stojanović Milena</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Vuković Anita</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Marković Danica</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">Janković Radmilo</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">In</subfield><subfield code="t">Serbian Journal of Anesthesia and Intensive Therapy</subfield><subfield code="d">Serbian Society of Anesthesiologists and Intensivists, 2017</subfield><subfield code="g">40(2018), 7-8, Seite 163-170</subfield><subfield code="w">(DE-627)1760609781</subfield><subfield code="x">2466488X</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:40</subfield><subfield code="g">year:2018</subfield><subfield code="g">number:7-8</subfield><subfield code="g">pages:163-170</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doaj.org/article/179e6a163dad44a2982565fa674ea0cc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://scindeks-clanci.ceon.rs/data/pdf/2217-7744/2018/2217-77441808163S.pdf</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/2466-488X</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/2466-488X</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_DOAJ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">40</subfield><subfield code="j">2018</subfield><subfield code="e">7-8</subfield><subfield code="h">163-170</subfield></datafield></record></collection>
|
score |
7.400819 |