Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique

In this work, an analytical study of the electromagnetic propagation in a complex medium-based suspended three-layer coplanar waveguide (CPW) is carried out. The study aims at a numerical calculation of the dominant hybrid mode complex propagation constant in the CPW printed on a bianisotropic subst...
Ausführliche Beschreibung

Gespeichert in:

Autor*in:	D. Sayad [verfasserIn] C. Zebiri [verfasserIn] I. Elfergani [verfasserIn] J. Rodriguez [verfasserIn] R. Abd-Alhameed [verfasserIn] F. Benabdelaziz [verfasserIn]

Format:	E-Artikel
Sprache:	Englisch

Erschienen:	2020

Schlagwörter:	cpw chiral and achiral tellegen full-gemt complex propagation constant

Übergeordnetes Werk:	In: Radioengineering - Spolecnost pro radioelektronicke inzenyrstvi, 2008, 29(2020), 4, Seite 591-600
Übergeordnetes Werk:	volume:29 ; year:2020 ; number:4 ; pages:591-600

Links:	Link aufrufen Link aufrufen Journal toc

Katalog-ID:	DOAJ054858909

Internformat


LEADER	01000caa a22002652 4500
001	DOAJ054858909
003	DE-627
005	20230308184527.0
007	cr uuu---uuuuu
008	230227s2020 xx \|\|\|\|\|o 00\| \|\|eng c
035			\|a (DE-627)DOAJ054858909
035			\|a (DE-599)DOAJe9cefc66f9eb44a3bfe686283a34a38b
040			\|a DE-627 \|b ger \|c DE-627 \|e rakwb
041			\|a eng
050		0	\|a TK1-9971
100	0		\|a D. Sayad \|e verfasserin \|4 aut
245	1	0	\|a Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique
264		1	\|c 2020
336			\|a Text \|b txt \|2 rdacontent
337			\|a Computermedien \|b c \|2 rdamedia
338			\|a Online-Ressource \|b cr \|2 rdacarrier
520			\|a In this work, an analytical study of the electromagnetic propagation in a complex medium-based suspended three-layer coplanar waveguide (CPW) is carried out. The study aims at a numerical calculation of the dominant hybrid mode complex propagation constant in the CPW printed on a bianisotropic substrate. The herein considered bianisotropy is characterized by full 3×3 tensors of permittivity, permeability and magnetoelectric parameters. The study is based on the numerical derivation of the Green's functions of such a complex medium in the spectral domain. The study is carried out using the Full Generalized Exponential Matrix Technique based on matrix-shaped compact mathematical formulations. The Spectral Method of Moments (SMoM) and the Galerkin's procedure are used to solve the resulting homogeneous system of equations. The effect of the chiral and achiral bianisotropy on the complex propagation constant is particularly investigated. Good agreements with available data for an anisotropic-medium-based suspended CPW structure are achieved. Various cases of chiral and achiral bianisotropy have been investigated, and particularly, the effect on the dispersion characteristics is presented and compared with cases of isotropic and bianisotropic Tellegen media.
650		4	\|a cpw
650		4	\|a chiral and achiral
650		4	\|a tellegen
650		4	\|a full-gemt
650		4	\|a complex propagation constant
653		0	\|a Electrical engineering. Electronics. Nuclear engineering
700	0		\|a C. Zebiri \|e verfasserin \|4 aut
700	0		\|a I. Elfergani \|e verfasserin \|4 aut
700	0		\|a J. Rodriguez \|e verfasserin \|4 aut
700	0		\|a R. Abd-Alhameed \|e verfasserin \|4 aut
700	0		\|a F. Benabdelaziz \|e verfasserin \|4 aut
773	0	8	\|i In \|t Radioengineering \|d Spolecnost pro radioelektronicke inzenyrstvi, 2008 \|g 29(2020), 4, Seite 591-600 \|w (DE-627)571430961 \|w (DE-600)2436258-X \|x 18059600 \|7 nnns
773	1	8	\|g volume:29 \|g year:2020 \|g number:4 \|g pages:591-600
856	4	0	\|u https://doaj.org/article/e9cefc66f9eb44a3bfe686283a34a38b \|z kostenfrei
856	4	0	\|u https://www.radioeng.cz/fulltexts/2020/20_04_0591_0600.pdf \|z kostenfrei
856	4	2	\|u https://doaj.org/toc/1210-2512 \|y Journal toc \|z kostenfrei
912			\|a GBV_USEFLAG_A
912			\|a SYSFLAG_A
912			\|a GBV_DOAJ
912			\|a GBV_ILN_20
912			\|a GBV_ILN_22
912			\|a GBV_ILN_23
912			\|a GBV_ILN_24
912			\|a GBV_ILN_31
912			\|a GBV_ILN_39
912			\|a GBV_ILN_40
912			\|a GBV_ILN_60
912			\|a GBV_ILN_62
912			\|a GBV_ILN_63
912			\|a GBV_ILN_65
912			\|a GBV_ILN_69
912			\|a GBV_ILN_70
912			\|a GBV_ILN_73
912			\|a GBV_ILN_95
912			\|a GBV_ILN_105
912			\|a GBV_ILN_110
912			\|a GBV_ILN_151
912			\|a GBV_ILN_161
912			\|a GBV_ILN_170
912			\|a GBV_ILN_213
912			\|a GBV_ILN_230
912			\|a GBV_ILN_285
912			\|a GBV_ILN_293
912			\|a GBV_ILN_370
912			\|a GBV_ILN_602
912			\|a GBV_ILN_2014
912			\|a GBV_ILN_2055
912			\|a GBV_ILN_4012
912			\|a GBV_ILN_4037
912			\|a GBV_ILN_4112
912			\|a GBV_ILN_4125
912			\|a GBV_ILN_4126
912			\|a GBV_ILN_4249
912			\|a GBV_ILN_4305
912			\|a GBV_ILN_4306
912			\|a GBV_ILN_4307
912			\|a GBV_ILN_4313
912			\|a GBV_ILN_4322
912			\|a GBV_ILN_4323
912			\|a GBV_ILN_4324
912			\|a GBV_ILN_4325
912			\|a GBV_ILN_4335
912			\|a GBV_ILN_4338
912			\|a GBV_ILN_4367
912			\|a GBV_ILN_4700
951			\|a AR
952			\|d 29 \|j 2020 \|e 4 \|h 591-600

Indexfelder

author_variant	d s ds c z cz i e ie j r jr r a a raa f b fb
matchkey_str	article:18059600:2020----::nlssfhrlnahrleimaecpaawvgiesnipoeflgnrlz
hierarchy_sort_str	2020
callnumber-subject-code	TK
publishDate	2020
allfields	(DE-627)DOAJ054858909 (DE-599)DOAJe9cefc66f9eb44a3bfe686283a34a38b DE-627 ger DE-627 rakwb eng TK1-9971 D. Sayad verfasserin aut Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique 2020 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier In this work, an analytical study of the electromagnetic propagation in a complex medium-based suspended three-layer coplanar waveguide (CPW) is carried out. The study aims at a numerical calculation of the dominant hybrid mode complex propagation constant in the CPW printed on a bianisotropic substrate. The herein considered bianisotropy is characterized by full 3×3 tensors of permittivity, permeability and magnetoelectric parameters. The study is based on the numerical derivation of the Green's functions of such a complex medium in the spectral domain. The study is carried out using the Full Generalized Exponential Matrix Technique based on matrix-shaped compact mathematical formulations. The Spectral Method of Moments (SMoM) and the Galerkin's procedure are used to solve the resulting homogeneous system of equations. The effect of the chiral and achiral bianisotropy on the complex propagation constant is particularly investigated. Good agreements with available data for an anisotropic-medium-based suspended CPW structure are achieved. Various cases of chiral and achiral bianisotropy have been investigated, and particularly, the effect on the dispersion characteristics is presented and compared with cases of isotropic and bianisotropic Tellegen media. cpw chiral and achiral tellegen full-gemt complex propagation constant Electrical engineering. Electronics. Nuclear engineering C. Zebiri verfasserin aut I. Elfergani verfasserin aut J. Rodriguez verfasserin aut R. Abd-Alhameed verfasserin aut F. Benabdelaziz verfasserin aut In Radioengineering Spolecnost pro radioelektronicke inzenyrstvi, 2008 29(2020), 4, Seite 591-600 (DE-627)571430961 (DE-600)2436258-X 18059600 nnns volume:29 year:2020 number:4 pages:591-600 https://doaj.org/article/e9cefc66f9eb44a3bfe686283a34a38b kostenfrei https://www.radioeng.cz/fulltexts/2020/20_04_0591_0600.pdf kostenfrei https://doaj.org/toc/1210-2512 Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ GBV_ILN_20 GBV_ILN_22 GBV_ILN_23 GBV_ILN_24 GBV_ILN_31 GBV_ILN_39 GBV_ILN_40 GBV_ILN_60 GBV_ILN_62 GBV_ILN_63 GBV_ILN_65 GBV_ILN_69 GBV_ILN_70 GBV_ILN_73 GBV_ILN_95 GBV_ILN_105 GBV_ILN_110 GBV_ILN_151 GBV_ILN_161 GBV_ILN_170 GBV_ILN_213 GBV_ILN_230 GBV_ILN_285 GBV_ILN_293 GBV_ILN_370 GBV_ILN_602 GBV_ILN_2014 GBV_ILN_2055 GBV_ILN_4012 GBV_ILN_4037 GBV_ILN_4112 GBV_ILN_4125 GBV_ILN_4126 GBV_ILN_4249 GBV_ILN_4305 GBV_ILN_4306 GBV_ILN_4307 GBV_ILN_4313 GBV_ILN_4322 GBV_ILN_4323 GBV_ILN_4324 GBV_ILN_4325 GBV_ILN_4335 GBV_ILN_4338 GBV_ILN_4367 GBV_ILN_4700 AR 29 2020 4 591-600
spelling	(DE-627)DOAJ054858909 (DE-599)DOAJe9cefc66f9eb44a3bfe686283a34a38b DE-627 ger DE-627 rakwb eng TK1-9971 D. Sayad verfasserin aut Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique 2020 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier In this work, an analytical study of the electromagnetic propagation in a complex medium-based suspended three-layer coplanar waveguide (CPW) is carried out. The study aims at a numerical calculation of the dominant hybrid mode complex propagation constant in the CPW printed on a bianisotropic substrate. The herein considered bianisotropy is characterized by full 3×3 tensors of permittivity, permeability and magnetoelectric parameters. The study is based on the numerical derivation of the Green's functions of such a complex medium in the spectral domain. The study is carried out using the Full Generalized Exponential Matrix Technique based on matrix-shaped compact mathematical formulations. The Spectral Method of Moments (SMoM) and the Galerkin's procedure are used to solve the resulting homogeneous system of equations. The effect of the chiral and achiral bianisotropy on the complex propagation constant is particularly investigated. Good agreements with available data for an anisotropic-medium-based suspended CPW structure are achieved. Various cases of chiral and achiral bianisotropy have been investigated, and particularly, the effect on the dispersion characteristics is presented and compared with cases of isotropic and bianisotropic Tellegen media. cpw chiral and achiral tellegen full-gemt complex propagation constant Electrical engineering. Electronics. Nuclear engineering C. Zebiri verfasserin aut I. Elfergani verfasserin aut J. Rodriguez verfasserin aut R. Abd-Alhameed verfasserin aut F. Benabdelaziz verfasserin aut In Radioengineering Spolecnost pro radioelektronicke inzenyrstvi, 2008 29(2020), 4, Seite 591-600 (DE-627)571430961 (DE-600)2436258-X 18059600 nnns volume:29 year:2020 number:4 pages:591-600 https://doaj.org/article/e9cefc66f9eb44a3bfe686283a34a38b kostenfrei https://www.radioeng.cz/fulltexts/2020/20_04_0591_0600.pdf kostenfrei https://doaj.org/toc/1210-2512 Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ GBV_ILN_20 GBV_ILN_22 GBV_ILN_23 GBV_ILN_24 GBV_ILN_31 GBV_ILN_39 GBV_ILN_40 GBV_ILN_60 GBV_ILN_62 GBV_ILN_63 GBV_ILN_65 GBV_ILN_69 GBV_ILN_70 GBV_ILN_73 GBV_ILN_95 GBV_ILN_105 GBV_ILN_110 GBV_ILN_151 GBV_ILN_161 GBV_ILN_170 GBV_ILN_213 GBV_ILN_230 GBV_ILN_285 GBV_ILN_293 GBV_ILN_370 GBV_ILN_602 GBV_ILN_2014 GBV_ILN_2055 GBV_ILN_4012 GBV_ILN_4037 GBV_ILN_4112 GBV_ILN_4125 GBV_ILN_4126 GBV_ILN_4249 GBV_ILN_4305 GBV_ILN_4306 GBV_ILN_4307 GBV_ILN_4313 GBV_ILN_4322 GBV_ILN_4323 GBV_ILN_4324 GBV_ILN_4325 GBV_ILN_4335 GBV_ILN_4338 GBV_ILN_4367 GBV_ILN_4700 AR 29 2020 4 591-600
allfields_unstemmed	(DE-627)DOAJ054858909 (DE-599)DOAJe9cefc66f9eb44a3bfe686283a34a38b DE-627 ger DE-627 rakwb eng TK1-9971 D. Sayad verfasserin aut Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique 2020 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier In this work, an analytical study of the electromagnetic propagation in a complex medium-based suspended three-layer coplanar waveguide (CPW) is carried out. The study aims at a numerical calculation of the dominant hybrid mode complex propagation constant in the CPW printed on a bianisotropic substrate. The herein considered bianisotropy is characterized by full 3×3 tensors of permittivity, permeability and magnetoelectric parameters. The study is based on the numerical derivation of the Green's functions of such a complex medium in the spectral domain. The study is carried out using the Full Generalized Exponential Matrix Technique based on matrix-shaped compact mathematical formulations. The Spectral Method of Moments (SMoM) and the Galerkin's procedure are used to solve the resulting homogeneous system of equations. The effect of the chiral and achiral bianisotropy on the complex propagation constant is particularly investigated. Good agreements with available data for an anisotropic-medium-based suspended CPW structure are achieved. Various cases of chiral and achiral bianisotropy have been investigated, and particularly, the effect on the dispersion characteristics is presented and compared with cases of isotropic and bianisotropic Tellegen media. cpw chiral and achiral tellegen full-gemt complex propagation constant Electrical engineering. Electronics. Nuclear engineering C. Zebiri verfasserin aut I. Elfergani verfasserin aut J. Rodriguez verfasserin aut R. Abd-Alhameed verfasserin aut F. Benabdelaziz verfasserin aut In Radioengineering Spolecnost pro radioelektronicke inzenyrstvi, 2008 29(2020), 4, Seite 591-600 (DE-627)571430961 (DE-600)2436258-X 18059600 nnns volume:29 year:2020 number:4 pages:591-600 https://doaj.org/article/e9cefc66f9eb44a3bfe686283a34a38b kostenfrei https://www.radioeng.cz/fulltexts/2020/20_04_0591_0600.pdf kostenfrei https://doaj.org/toc/1210-2512 Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ GBV_ILN_20 GBV_ILN_22 GBV_ILN_23 GBV_ILN_24 GBV_ILN_31 GBV_ILN_39 GBV_ILN_40 GBV_ILN_60 GBV_ILN_62 GBV_ILN_63 GBV_ILN_65 GBV_ILN_69 GBV_ILN_70 GBV_ILN_73 GBV_ILN_95 GBV_ILN_105 GBV_ILN_110 GBV_ILN_151 GBV_ILN_161 GBV_ILN_170 GBV_ILN_213 GBV_ILN_230 GBV_ILN_285 GBV_ILN_293 GBV_ILN_370 GBV_ILN_602 GBV_ILN_2014 GBV_ILN_2055 GBV_ILN_4012 GBV_ILN_4037 GBV_ILN_4112 GBV_ILN_4125 GBV_ILN_4126 GBV_ILN_4249 GBV_ILN_4305 GBV_ILN_4306 GBV_ILN_4307 GBV_ILN_4313 GBV_ILN_4322 GBV_ILN_4323 GBV_ILN_4324 GBV_ILN_4325 GBV_ILN_4335 GBV_ILN_4338 GBV_ILN_4367 GBV_ILN_4700 AR 29 2020 4 591-600
allfieldsGer	(DE-627)DOAJ054858909 (DE-599)DOAJe9cefc66f9eb44a3bfe686283a34a38b DE-627 ger DE-627 rakwb eng TK1-9971 D. Sayad verfasserin aut Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique 2020 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier In this work, an analytical study of the electromagnetic propagation in a complex medium-based suspended three-layer coplanar waveguide (CPW) is carried out. The study aims at a numerical calculation of the dominant hybrid mode complex propagation constant in the CPW printed on a bianisotropic substrate. The herein considered bianisotropy is characterized by full 3×3 tensors of permittivity, permeability and magnetoelectric parameters. The study is based on the numerical derivation of the Green's functions of such a complex medium in the spectral domain. The study is carried out using the Full Generalized Exponential Matrix Technique based on matrix-shaped compact mathematical formulations. The Spectral Method of Moments (SMoM) and the Galerkin's procedure are used to solve the resulting homogeneous system of equations. The effect of the chiral and achiral bianisotropy on the complex propagation constant is particularly investigated. Good agreements with available data for an anisotropic-medium-based suspended CPW structure are achieved. Various cases of chiral and achiral bianisotropy have been investigated, and particularly, the effect on the dispersion characteristics is presented and compared with cases of isotropic and bianisotropic Tellegen media. cpw chiral and achiral tellegen full-gemt complex propagation constant Electrical engineering. Electronics. Nuclear engineering C. Zebiri verfasserin aut I. Elfergani verfasserin aut J. Rodriguez verfasserin aut R. Abd-Alhameed verfasserin aut F. Benabdelaziz verfasserin aut In Radioengineering Spolecnost pro radioelektronicke inzenyrstvi, 2008 29(2020), 4, Seite 591-600 (DE-627)571430961 (DE-600)2436258-X 18059600 nnns volume:29 year:2020 number:4 pages:591-600 https://doaj.org/article/e9cefc66f9eb44a3bfe686283a34a38b kostenfrei https://www.radioeng.cz/fulltexts/2020/20_04_0591_0600.pdf kostenfrei https://doaj.org/toc/1210-2512 Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ GBV_ILN_20 GBV_ILN_22 GBV_ILN_23 GBV_ILN_24 GBV_ILN_31 GBV_ILN_39 GBV_ILN_40 GBV_ILN_60 GBV_ILN_62 GBV_ILN_63 GBV_ILN_65 GBV_ILN_69 GBV_ILN_70 GBV_ILN_73 GBV_ILN_95 GBV_ILN_105 GBV_ILN_110 GBV_ILN_151 GBV_ILN_161 GBV_ILN_170 GBV_ILN_213 GBV_ILN_230 GBV_ILN_285 GBV_ILN_293 GBV_ILN_370 GBV_ILN_602 GBV_ILN_2014 GBV_ILN_2055 GBV_ILN_4012 GBV_ILN_4037 GBV_ILN_4112 GBV_ILN_4125 GBV_ILN_4126 GBV_ILN_4249 GBV_ILN_4305 GBV_ILN_4306 GBV_ILN_4307 GBV_ILN_4313 GBV_ILN_4322 GBV_ILN_4323 GBV_ILN_4324 GBV_ILN_4325 GBV_ILN_4335 GBV_ILN_4338 GBV_ILN_4367 GBV_ILN_4700 AR 29 2020 4 591-600
allfieldsSound	(DE-627)DOAJ054858909 (DE-599)DOAJe9cefc66f9eb44a3bfe686283a34a38b DE-627 ger DE-627 rakwb eng TK1-9971 D. Sayad verfasserin aut Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique 2020 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier In this work, an analytical study of the electromagnetic propagation in a complex medium-based suspended three-layer coplanar waveguide (CPW) is carried out. The study aims at a numerical calculation of the dominant hybrid mode complex propagation constant in the CPW printed on a bianisotropic substrate. The herein considered bianisotropy is characterized by full 3×3 tensors of permittivity, permeability and magnetoelectric parameters. The study is based on the numerical derivation of the Green's functions of such a complex medium in the spectral domain. The study is carried out using the Full Generalized Exponential Matrix Technique based on matrix-shaped compact mathematical formulations. The Spectral Method of Moments (SMoM) and the Galerkin's procedure are used to solve the resulting homogeneous system of equations. The effect of the chiral and achiral bianisotropy on the complex propagation constant is particularly investigated. Good agreements with available data for an anisotropic-medium-based suspended CPW structure are achieved. Various cases of chiral and achiral bianisotropy have been investigated, and particularly, the effect on the dispersion characteristics is presented and compared with cases of isotropic and bianisotropic Tellegen media. cpw chiral and achiral tellegen full-gemt complex propagation constant Electrical engineering. Electronics. Nuclear engineering C. Zebiri verfasserin aut I. Elfergani verfasserin aut J. Rodriguez verfasserin aut R. Abd-Alhameed verfasserin aut F. Benabdelaziz verfasserin aut In Radioengineering Spolecnost pro radioelektronicke inzenyrstvi, 2008 29(2020), 4, Seite 591-600 (DE-627)571430961 (DE-600)2436258-X 18059600 nnns volume:29 year:2020 number:4 pages:591-600 https://doaj.org/article/e9cefc66f9eb44a3bfe686283a34a38b kostenfrei https://www.radioeng.cz/fulltexts/2020/20_04_0591_0600.pdf kostenfrei https://doaj.org/toc/1210-2512 Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ GBV_ILN_20 GBV_ILN_22 GBV_ILN_23 GBV_ILN_24 GBV_ILN_31 GBV_ILN_39 GBV_ILN_40 GBV_ILN_60 GBV_ILN_62 GBV_ILN_63 GBV_ILN_65 GBV_ILN_69 GBV_ILN_70 GBV_ILN_73 GBV_ILN_95 GBV_ILN_105 GBV_ILN_110 GBV_ILN_151 GBV_ILN_161 GBV_ILN_170 GBV_ILN_213 GBV_ILN_230 GBV_ILN_285 GBV_ILN_293 GBV_ILN_370 GBV_ILN_602 GBV_ILN_2014 GBV_ILN_2055 GBV_ILN_4012 GBV_ILN_4037 GBV_ILN_4112 GBV_ILN_4125 GBV_ILN_4126 GBV_ILN_4249 GBV_ILN_4305 GBV_ILN_4306 GBV_ILN_4307 GBV_ILN_4313 GBV_ILN_4322 GBV_ILN_4323 GBV_ILN_4324 GBV_ILN_4325 GBV_ILN_4335 GBV_ILN_4338 GBV_ILN_4367 GBV_ILN_4700 AR 29 2020 4 591-600
language	English
source	In Radioengineering 29(2020), 4, Seite 591-600 volume:29 year:2020 number:4 pages:591-600
sourceStr	In Radioengineering 29(2020), 4, Seite 591-600 volume:29 year:2020 number:4 pages:591-600
format_phy_str_mv	Article
institution	findex.gbv.de
topic_facet	cpw chiral and achiral tellegen full-gemt complex propagation constant Electrical engineering. Electronics. Nuclear engineering
isfreeaccess_bool	true
container_title	Radioengineering
authorswithroles_txt_mv	D. Sayad @@aut@@ C. Zebiri @@aut@@ I. Elfergani @@aut@@ J. Rodriguez @@aut@@ R. Abd-Alhameed @@aut@@ F. Benabdelaziz @@aut@@
publishDateDaySort_date	2020-01-01T00:00:00Z
hierarchy_top_id	571430961
id	DOAJ054858909
language_de	englisch
fullrecord	<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">DOAJ054858909</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230308184527.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">230227s2020 xx \|\|\|\|\|o 00\| \|\|eng c</controlfield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)DOAJ054858909</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)DOAJe9cefc66f9eb44a3bfe686283a34a38b</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">TK1-9971</subfield></datafield><datafield tag="100" ind1="0" ind2=" "><subfield code="a">D. Sayad</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2020</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">Text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">Computermedien</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">Online-Ressource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">In this work, an analytical study of the electromagnetic propagation in a complex medium-based suspended three-layer coplanar waveguide (CPW) is carried out. The study aims at a numerical calculation of the dominant hybrid mode complex propagation constant in the CPW printed on a bianisotropic substrate. The herein considered bianisotropy is characterized by full 3×3 tensors of permittivity, permeability and magnetoelectric parameters. The study is based on the numerical derivation of the Green's functions of such a complex medium in the spectral domain. The study is carried out using the Full Generalized Exponential Matrix Technique based on matrix-shaped compact mathematical formulations. The Spectral Method of Moments (SMoM) and the Galerkin's procedure are used to solve the resulting homogeneous system of equations. The effect of the chiral and achiral bianisotropy on the complex propagation constant is particularly investigated. Good agreements with available data for an anisotropic-medium-based suspended CPW structure are achieved. Various cases of chiral and achiral bianisotropy have been investigated, and particularly, the effect on the dispersion characteristics is presented and compared with cases of isotropic and bianisotropic Tellegen media.</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">cpw</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">chiral and achiral</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">tellegen</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">full-gemt</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">complex propagation constant</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Electrical engineering. Electronics. Nuclear engineering</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">C. Zebiri</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">I. Elfergani</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">J. Rodriguez</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">R. Abd-Alhameed</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">F. Benabdelaziz</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">In</subfield><subfield code="t">Radioengineering</subfield><subfield code="d">Spolecnost pro radioelektronicke inzenyrstvi, 2008</subfield><subfield code="g">29(2020), 4, Seite 591-600</subfield><subfield code="w">(DE-627)571430961</subfield><subfield code="w">(DE-600)2436258-X</subfield><subfield code="x">18059600</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:29</subfield><subfield code="g">year:2020</subfield><subfield code="g">number:4</subfield><subfield code="g">pages:591-600</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doaj.org/article/e9cefc66f9eb44a3bfe686283a34a38b</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://www.radioeng.cz/fulltexts/2020/20_04_0591_0600.pdf</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/1210-2512</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_DOAJ</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_20</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_22</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_23</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_24</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_31</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_39</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_40</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_60</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_62</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_63</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_65</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_69</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_70</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_73</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_95</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_105</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_110</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_151</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_161</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_170</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_213</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_230</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_285</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_293</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_370</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_602</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2014</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2055</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4012</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4037</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4112</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4125</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4126</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4249</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4305</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4306</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4307</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4313</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4322</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4323</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4324</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4325</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4335</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4338</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4367</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4700</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">29</subfield><subfield code="j">2020</subfield><subfield code="e">4</subfield><subfield code="h">591-600</subfield></datafield></record></collection>
callnumber-first	T - Technology
author	D. Sayad
spellingShingle	D. Sayad misc TK1-9971 misc cpw misc chiral and achiral misc tellegen misc full-gemt misc complex propagation constant misc Electrical engineering. Electronics. Nuclear engineering Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique
authorStr	D. Sayad
ppnlink_with_tag_str_mv	@@773@@(DE-627)571430961
format	electronic Article
delete_txt_mv	keep
author_role	aut aut aut aut aut aut
collection	DOAJ
remote_str	true
callnumber-label	TK1-9971
illustrated	Not Illustrated
issn	18059600
topic_title	TK1-9971 Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique cpw chiral and achiral tellegen full-gemt complex propagation constant
topic	misc TK1-9971 misc cpw misc chiral and achiral misc tellegen misc full-gemt misc complex propagation constant misc Electrical engineering. Electronics. Nuclear engineering
topic_unstemmed	misc TK1-9971 misc cpw misc chiral and achiral misc tellegen misc full-gemt misc complex propagation constant misc Electrical engineering. Electronics. Nuclear engineering
topic_browse	misc TK1-9971 misc cpw misc chiral and achiral misc tellegen misc full-gemt misc complex propagation constant misc Electrical engineering. Electronics. Nuclear engineering
format_facet	Elektronische Aufsätze Aufsätze Elektronische Ressource
format_main_str_mv	Text Zeitschrift/Artikel
carriertype_str_mv	cr
hierarchy_parent_title	Radioengineering
hierarchy_parent_id	571430961
hierarchy_top_title	Radioengineering
isfreeaccess_txt	true
familylinks_str_mv	(DE-627)571430961 (DE-600)2436258-X
title	Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique
ctrlnum	(DE-627)DOAJ054858909 (DE-599)DOAJe9cefc66f9eb44a3bfe686283a34a38b
title_full	Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique
author_sort	D. Sayad
journal	Radioengineering
journalStr	Radioengineering
callnumber-first-code	T
lang_code	eng
isOA_bool	true
recordtype	marc
publishDateSort	2020
contenttype_str_mv	txt
container_start_page	591
author_browse	D. Sayad C. Zebiri I. Elfergani J. Rodriguez R. Abd-Alhameed F. Benabdelaziz
container_volume	29
class	TK1-9971
format_se	Elektronische Aufsätze
author-letter	D. Sayad
author2-role	verfasserin
title_sort	analysis of chiral and achiral medium based coplanar waveguide using improved full generalized exponential matrix technique
callnumber	TK1-9971
title_auth	Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique
abstract	In this work, an analytical study of the electromagnetic propagation in a complex medium-based suspended three-layer coplanar waveguide (CPW) is carried out. The study aims at a numerical calculation of the dominant hybrid mode complex propagation constant in the CPW printed on a bianisotropic substrate. The herein considered bianisotropy is characterized by full 3×3 tensors of permittivity, permeability and magnetoelectric parameters. The study is based on the numerical derivation of the Green's functions of such a complex medium in the spectral domain. The study is carried out using the Full Generalized Exponential Matrix Technique based on matrix-shaped compact mathematical formulations. The Spectral Method of Moments (SMoM) and the Galerkin's procedure are used to solve the resulting homogeneous system of equations. The effect of the chiral and achiral bianisotropy on the complex propagation constant is particularly investigated. Good agreements with available data for an anisotropic-medium-based suspended CPW structure are achieved. Various cases of chiral and achiral bianisotropy have been investigated, and particularly, the effect on the dispersion characteristics is presented and compared with cases of isotropic and bianisotropic Tellegen media.
abstractGer	In this work, an analytical study of the electromagnetic propagation in a complex medium-based suspended three-layer coplanar waveguide (CPW) is carried out. The study aims at a numerical calculation of the dominant hybrid mode complex propagation constant in the CPW printed on a bianisotropic substrate. The herein considered bianisotropy is characterized by full 3×3 tensors of permittivity, permeability and magnetoelectric parameters. The study is based on the numerical derivation of the Green's functions of such a complex medium in the spectral domain. The study is carried out using the Full Generalized Exponential Matrix Technique based on matrix-shaped compact mathematical formulations. The Spectral Method of Moments (SMoM) and the Galerkin's procedure are used to solve the resulting homogeneous system of equations. The effect of the chiral and achiral bianisotropy on the complex propagation constant is particularly investigated. Good agreements with available data for an anisotropic-medium-based suspended CPW structure are achieved. Various cases of chiral and achiral bianisotropy have been investigated, and particularly, the effect on the dispersion characteristics is presented and compared with cases of isotropic and bianisotropic Tellegen media.
abstract_unstemmed	In this work, an analytical study of the electromagnetic propagation in a complex medium-based suspended three-layer coplanar waveguide (CPW) is carried out. The study aims at a numerical calculation of the dominant hybrid mode complex propagation constant in the CPW printed on a bianisotropic substrate. The herein considered bianisotropy is characterized by full 3×3 tensors of permittivity, permeability and magnetoelectric parameters. The study is based on the numerical derivation of the Green's functions of such a complex medium in the spectral domain. The study is carried out using the Full Generalized Exponential Matrix Technique based on matrix-shaped compact mathematical formulations. The Spectral Method of Moments (SMoM) and the Galerkin's procedure are used to solve the resulting homogeneous system of equations. The effect of the chiral and achiral bianisotropy on the complex propagation constant is particularly investigated. Good agreements with available data for an anisotropic-medium-based suspended CPW structure are achieved. Various cases of chiral and achiral bianisotropy have been investigated, and particularly, the effect on the dispersion characteristics is presented and compared with cases of isotropic and bianisotropic Tellegen media.
collection_details	GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ GBV_ILN_20 GBV_ILN_22 GBV_ILN_23 GBV_ILN_24 GBV_ILN_31 GBV_ILN_39 GBV_ILN_40 GBV_ILN_60 GBV_ILN_62 GBV_ILN_63 GBV_ILN_65 GBV_ILN_69 GBV_ILN_70 GBV_ILN_73 GBV_ILN_95 GBV_ILN_105 GBV_ILN_110 GBV_ILN_151 GBV_ILN_161 GBV_ILN_170 GBV_ILN_213 GBV_ILN_230 GBV_ILN_285 GBV_ILN_293 GBV_ILN_370 GBV_ILN_602 GBV_ILN_2014 GBV_ILN_2055 GBV_ILN_4012 GBV_ILN_4037 GBV_ILN_4112 GBV_ILN_4125 GBV_ILN_4126 GBV_ILN_4249 GBV_ILN_4305 GBV_ILN_4306 GBV_ILN_4307 GBV_ILN_4313 GBV_ILN_4322 GBV_ILN_4323 GBV_ILN_4324 GBV_ILN_4325 GBV_ILN_4335 GBV_ILN_4338 GBV_ILN_4367 GBV_ILN_4700
container_issue	4
title_short	Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique
url	https://doaj.org/article/e9cefc66f9eb44a3bfe686283a34a38b https://www.radioeng.cz/fulltexts/2020/20_04_0591_0600.pdf https://doaj.org/toc/1210-2512
remote_bool	true
author2	C. Zebiri I. Elfergani J. Rodriguez R. Abd-Alhameed F. Benabdelaziz
author2Str	C. Zebiri I. Elfergani J. Rodriguez R. Abd-Alhameed F. Benabdelaziz
ppnlink	571430961
callnumber-subject	TK - Electrical and Nuclear Engineering
mediatype_str_mv	c
isOA_txt	true
hochschulschrift_bool	false
callnumber-a	TK1-9971
up_date	2024-07-04T00:53:19.106Z
_version_	1803607761598021632
fullrecord_marcxml	<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">DOAJ054858909</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230308184527.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">230227s2020 xx \|\|\|\|\|o 00\| \|\|eng c</controlfield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)DOAJ054858909</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)DOAJe9cefc66f9eb44a3bfe686283a34a38b</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">TK1-9971</subfield></datafield><datafield tag="100" ind1="0" ind2=" "><subfield code="a">D. Sayad</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2020</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">Text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">Computermedien</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">Online-Ressource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">In this work, an analytical study of the electromagnetic propagation in a complex medium-based suspended three-layer coplanar waveguide (CPW) is carried out. The study aims at a numerical calculation of the dominant hybrid mode complex propagation constant in the CPW printed on a bianisotropic substrate. The herein considered bianisotropy is characterized by full 3×3 tensors of permittivity, permeability and magnetoelectric parameters. The study is based on the numerical derivation of the Green's functions of such a complex medium in the spectral domain. The study is carried out using the Full Generalized Exponential Matrix Technique based on matrix-shaped compact mathematical formulations. The Spectral Method of Moments (SMoM) and the Galerkin's procedure are used to solve the resulting homogeneous system of equations. The effect of the chiral and achiral bianisotropy on the complex propagation constant is particularly investigated. Good agreements with available data for an anisotropic-medium-based suspended CPW structure are achieved. Various cases of chiral and achiral bianisotropy have been investigated, and particularly, the effect on the dispersion characteristics is presented and compared with cases of isotropic and bianisotropic Tellegen media.</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">cpw</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">chiral and achiral</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">tellegen</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">full-gemt</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">complex propagation constant</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Electrical engineering. Electronics. Nuclear engineering</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">C. Zebiri</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">I. Elfergani</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">J. Rodriguez</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">R. Abd-Alhameed</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">F. Benabdelaziz</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">In</subfield><subfield code="t">Radioengineering</subfield><subfield code="d">Spolecnost pro radioelektronicke inzenyrstvi, 2008</subfield><subfield code="g">29(2020), 4, Seite 591-600</subfield><subfield code="w">(DE-627)571430961</subfield><subfield code="w">(DE-600)2436258-X</subfield><subfield code="x">18059600</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:29</subfield><subfield code="g">year:2020</subfield><subfield code="g">number:4</subfield><subfield code="g">pages:591-600</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doaj.org/article/e9cefc66f9eb44a3bfe686283a34a38b</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://www.radioeng.cz/fulltexts/2020/20_04_0591_0600.pdf</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/1210-2512</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_DOAJ</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_20</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_22</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_23</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_24</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_31</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_39</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_40</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_60</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_62</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_63</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_65</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_69</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_70</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_73</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_95</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_105</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_110</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_151</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_161</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_170</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_213</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_230</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_285</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_293</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_370</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_602</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2014</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2055</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4012</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4037</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4112</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4125</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4126</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4249</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4305</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4306</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4307</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4313</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4322</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4323</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4324</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4325</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4335</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4338</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4367</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4700</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">29</subfield><subfield code="j">2020</subfield><subfield code="e">4</subfield><subfield code="h">591-600</subfield></datafield></record></collection>
score	7.4013624

Nicht das Richtige dabei?

Schreiben Sie uns!

Analysis of Chiral and Achiral Medium Based Coplanar Waveguide Using Improved Full Generalized Exponential Matrix Technique

Nicht das Richtige dabei?

Zugang & Verfügbarkeit

Vorhandene Bände

Nicht das Richtige dabei?