Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region
The study of white lupine samples of grain-forage direction developed by the All-Russian Research Institute of Lupine were carried out for three years (2019–2021) on the fields of the collection farm of the of the department of plant production, breeding and olericulture of the Belgorod State Agrari...
Ausführliche Beschreibung
Gespeichert in:
| Autor*in: |
A. S. Blinnik [verfasserIn] M. I. Lukashevich [verfasserIn] A. G. Demidova [verfasserIn] O. Yu. Artemova [verfasserIn] V. N. Naumkin [verfasserIn] L. A. Naumkina [verfasserIn] |
|---|
| Format: |
E-Artikel |
|---|---|
| Sprache: |
Russisch |
| Erschienen: |
2022 |
|---|
| Schlagwörter: |
|---|
| Übergeordnetes Werk: |
In: Зерновое хозяйство России - Federal State Budgetary Scientific Institution “Agricultural Research Center “Donskoy”", 2019, (2022), 5, Seite 20-25 |
|---|---|
| Übergeordnetes Werk: |
year:2022 ; number:5 ; pages:20-25 |
| Links: |
Link aufrufen |
|---|
| DOI / URN: |
10.31367/2079-8725-2022-82-5-20-25 |
|---|
| Katalog-ID: |
DOAJ088649431 |
|---|
| LEADER | 01000naa a22002652 4500 | ||
|---|---|---|---|
| 001 | DOAJ088649431 | ||
| 003 | DE-627 | ||
| 005 | 20230410114631.0 | ||
| 007 | cr uuu---uuuuu | ||
| 008 | 230410s2022 xx |||||o 00| ||rus c | ||
| 024 | 7 | |a 10.31367/2079-8725-2022-82-5-20-25 |2 doi | |
| 035 | |a (DE-627)DOAJ088649431 | ||
| 035 | |a (DE-599)DOAJ241cec8310ba46c5b296a4314ae88efe | ||
| 040 | |a DE-627 |b ger |c DE-627 |e rakwb | ||
| 041 | |a rus | ||
| 050 | 0 | |a S1-972 | |
| 100 | 0 | |a A. S. Blinnik |e verfasserin |4 aut | |
| 245 | 1 | 0 | |a Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region |
| 264 | 1 | |c 2022 | |
| 336 | |a Text |b txt |2 rdacontent | ||
| 337 | |a Computermedien |b c |2 rdamedia | ||
| 338 | |a Online-Ressource |b cr |2 rdacarrier | ||
| 520 | |a The study of white lupine samples of grain-forage direction developed by the All-Russian Research Institute of Lupine were carried out for three years (2019–2021) on the fields of the collection farm of the of the department of plant production, breeding and olericulture of the Belgorod State Agrarian University named after V.Ya. Gorin. There have been studied 4 varieties and 26 lines, the variety ‘Michurinsky’ was the standard in the trial. According to the seed productivity in all years of study, most varieties and lines significantly exceeded the standard. On average for 3 years, the most productive lines were ‘SN 17-14’, ‘SN 54-08’ and ‘SN 12–13’, which increase ranged from 43 to 48 % in comparison with the standard variety. Productivity increase from 34 to 39 % was given by the lines ‘SN 816-09’, ‘SN 1735-10’, ‘SN 35-13’ and ‘SN 77-17’. The increase of the varieties ‘Pilgrim’ and ‘Aliy parus’ and four lines ‘SN 18-13’, ‘SN 15-13’, ‘SN 55-14’, ‘SN 138-16’ varied from 21 to 26 % compared to the standard. The variety ‘Timiryazevsky’ and lines ‘SN 1397-10’, ‘SN 78-16’ and ‘SN 25-11’ exceeded the standard on 13–18 %. At the same time, the lines ‘SN 76-16’ and ‘SN 1022-09’ produced the lowest yields, significantly inferior to the standard. The calculation of the adaptability coefficient has shown that the varieties and lines that provided high and stable seed productivity over the years are also highly adaptive to the arid conditions of the region, since this coefficient has exceeded 100 %. The protein percentge in seeds on average for 3 years ranged from 29.55 to 36.45 % with 32.27 % for the standard. Its percentage exceeded 35.0 % among 7 lines and the variety ‘Pilgrim’. The oil content in seeds of the white lupine varieties and lines on average for 3 years ranged from 10.00 to 11.54 %. Most varieties and lines in the trial according to the content of alkaloids in seeds belong to the group of low alkaloids (up to 0.099 %) and medium alkaloids (up to 0.299 %). | ||
| 650 | 4 | |a люпин белый | |
| 650 | 4 | |a сорта | |
| 650 | 4 | |a линии | |
| 650 | 4 | |a урожайность семян | |
| 650 | 4 | |a стрессоустойчивость | |
| 650 | 4 | |a компенсаторная способность | |
| 650 | 4 | |a протеин | |
| 650 | 4 | |a жир | |
| 653 | 0 | |a Agriculture (General) | |
| 700 | 0 | |a M. I. Lukashevich |e verfasserin |4 aut | |
| 700 | 0 | |a A. G. Demidova |e verfasserin |4 aut | |
| 700 | 0 | |a O. Yu. Artemova |e verfasserin |4 aut | |
| 700 | 0 | |a V. N. Naumkin |e verfasserin |4 aut | |
| 700 | 0 | |a L. A. Naumkina |e verfasserin |4 aut | |
| 773 | 0 | 8 | |i In |t Зерновое хозяйство России |d Federal State Budgetary Scientific Institution “Agricultural Research Center “Donskoy”", 2019 |g (2022), 5, Seite 20-25 |w (DE-627)1760633550 |x 20798733 |7 nnns |
| 773 | 1 | 8 | |g year:2022 |g number:5 |g pages:20-25 |
| 856 | 4 | 0 | |u https://doi.org/10.31367/2079-8725-2022-82-5-20-25 |z kostenfrei |
| 856 | 4 | 0 | |u https://doaj.org/article/241cec8310ba46c5b296a4314ae88efe |z kostenfrei |
| 856 | 4 | 0 | |u https://www.zhros.online/jour/article/view/2043 |z kostenfrei |
| 856 | 4 | 2 | |u https://doaj.org/toc/2079-8725 |y Journal toc |z kostenfrei |
| 856 | 4 | 2 | |u https://doaj.org/toc/2079-8733 |y Journal toc |z kostenfrei |
| 912 | |a GBV_USEFLAG_A | ||
| 912 | |a SYSFLAG_A | ||
| 912 | |a GBV_DOAJ | ||
| 951 | |a AR | ||
| 952 | |j 2022 |e 5 |h 20-25 | ||
| author_variant |
a s b asb m i l mil a g d agd o y a oya v n n vnn l a n lan |
|---|---|
| matchkey_str |
article:20798733:2022----::rdciiynseqaiyfhnwhtlpnvreisnlnsnh |
| hierarchy_sort_str |
2022 |
| callnumber-subject-code |
S |
| publishDate |
2022 |
| allfields |
10.31367/2079-8725-2022-82-5-20-25 doi (DE-627)DOAJ088649431 (DE-599)DOAJ241cec8310ba46c5b296a4314ae88efe DE-627 ger DE-627 rakwb rus S1-972 A. S. Blinnik verfasserin aut Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region 2022 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier The study of white lupine samples of grain-forage direction developed by the All-Russian Research Institute of Lupine were carried out for three years (2019–2021) on the fields of the collection farm of the of the department of plant production, breeding and olericulture of the Belgorod State Agrarian University named after V.Ya. Gorin. There have been studied 4 varieties and 26 lines, the variety ‘Michurinsky’ was the standard in the trial. According to the seed productivity in all years of study, most varieties and lines significantly exceeded the standard. On average for 3 years, the most productive lines were ‘SN 17-14’, ‘SN 54-08’ and ‘SN 12–13’, which increase ranged from 43 to 48 % in comparison with the standard variety. Productivity increase from 34 to 39 % was given by the lines ‘SN 816-09’, ‘SN 1735-10’, ‘SN 35-13’ and ‘SN 77-17’. The increase of the varieties ‘Pilgrim’ and ‘Aliy parus’ and four lines ‘SN 18-13’, ‘SN 15-13’, ‘SN 55-14’, ‘SN 138-16’ varied from 21 to 26 % compared to the standard. The variety ‘Timiryazevsky’ and lines ‘SN 1397-10’, ‘SN 78-16’ and ‘SN 25-11’ exceeded the standard on 13–18 %. At the same time, the lines ‘SN 76-16’ and ‘SN 1022-09’ produced the lowest yields, significantly inferior to the standard. The calculation of the adaptability coefficient has shown that the varieties and lines that provided high and stable seed productivity over the years are also highly adaptive to the arid conditions of the region, since this coefficient has exceeded 100 %. The protein percentge in seeds on average for 3 years ranged from 29.55 to 36.45 % with 32.27 % for the standard. Its percentage exceeded 35.0 % among 7 lines and the variety ‘Pilgrim’. The oil content in seeds of the white lupine varieties and lines on average for 3 years ranged from 10.00 to 11.54 %. Most varieties and lines in the trial according to the content of alkaloids in seeds belong to the group of low alkaloids (up to 0.099 %) and medium alkaloids (up to 0.299 %). люпин белый сорта линии урожайность семян стрессоустойчивость компенсаторная способность протеин жир Agriculture (General) M. I. Lukashevich verfasserin aut A. G. Demidova verfasserin aut O. Yu. Artemova verfasserin aut V. N. Naumkin verfasserin aut L. A. Naumkina verfasserin aut In Зерновое хозяйство России Federal State Budgetary Scientific Institution “Agricultural Research Center “Donskoy”", 2019 (2022), 5, Seite 20-25 (DE-627)1760633550 20798733 nnns year:2022 number:5 pages:20-25 https://doi.org/10.31367/2079-8725-2022-82-5-20-25 kostenfrei https://doaj.org/article/241cec8310ba46c5b296a4314ae88efe kostenfrei https://www.zhros.online/jour/article/view/2043 kostenfrei https://doaj.org/toc/2079-8725 Journal toc kostenfrei https://doaj.org/toc/2079-8733 Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 2022 5 20-25 |
| spelling |
10.31367/2079-8725-2022-82-5-20-25 doi (DE-627)DOAJ088649431 (DE-599)DOAJ241cec8310ba46c5b296a4314ae88efe DE-627 ger DE-627 rakwb rus S1-972 A. S. Blinnik verfasserin aut Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region 2022 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier The study of white lupine samples of grain-forage direction developed by the All-Russian Research Institute of Lupine were carried out for three years (2019–2021) on the fields of the collection farm of the of the department of plant production, breeding and olericulture of the Belgorod State Agrarian University named after V.Ya. Gorin. There have been studied 4 varieties and 26 lines, the variety ‘Michurinsky’ was the standard in the trial. According to the seed productivity in all years of study, most varieties and lines significantly exceeded the standard. On average for 3 years, the most productive lines were ‘SN 17-14’, ‘SN 54-08’ and ‘SN 12–13’, which increase ranged from 43 to 48 % in comparison with the standard variety. Productivity increase from 34 to 39 % was given by the lines ‘SN 816-09’, ‘SN 1735-10’, ‘SN 35-13’ and ‘SN 77-17’. The increase of the varieties ‘Pilgrim’ and ‘Aliy parus’ and four lines ‘SN 18-13’, ‘SN 15-13’, ‘SN 55-14’, ‘SN 138-16’ varied from 21 to 26 % compared to the standard. The variety ‘Timiryazevsky’ and lines ‘SN 1397-10’, ‘SN 78-16’ and ‘SN 25-11’ exceeded the standard on 13–18 %. At the same time, the lines ‘SN 76-16’ and ‘SN 1022-09’ produced the lowest yields, significantly inferior to the standard. The calculation of the adaptability coefficient has shown that the varieties and lines that provided high and stable seed productivity over the years are also highly adaptive to the arid conditions of the region, since this coefficient has exceeded 100 %. The protein percentge in seeds on average for 3 years ranged from 29.55 to 36.45 % with 32.27 % for the standard. Its percentage exceeded 35.0 % among 7 lines and the variety ‘Pilgrim’. The oil content in seeds of the white lupine varieties and lines on average for 3 years ranged from 10.00 to 11.54 %. Most varieties and lines in the trial according to the content of alkaloids in seeds belong to the group of low alkaloids (up to 0.099 %) and medium alkaloids (up to 0.299 %). люпин белый сорта линии урожайность семян стрессоустойчивость компенсаторная способность протеин жир Agriculture (General) M. I. Lukashevich verfasserin aut A. G. Demidova verfasserin aut O. Yu. Artemova verfasserin aut V. N. Naumkin verfasserin aut L. A. Naumkina verfasserin aut In Зерновое хозяйство России Federal State Budgetary Scientific Institution “Agricultural Research Center “Donskoy”", 2019 (2022), 5, Seite 20-25 (DE-627)1760633550 20798733 nnns year:2022 number:5 pages:20-25 https://doi.org/10.31367/2079-8725-2022-82-5-20-25 kostenfrei https://doaj.org/article/241cec8310ba46c5b296a4314ae88efe kostenfrei https://www.zhros.online/jour/article/view/2043 kostenfrei https://doaj.org/toc/2079-8725 Journal toc kostenfrei https://doaj.org/toc/2079-8733 Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 2022 5 20-25 |
| allfields_unstemmed |
10.31367/2079-8725-2022-82-5-20-25 doi (DE-627)DOAJ088649431 (DE-599)DOAJ241cec8310ba46c5b296a4314ae88efe DE-627 ger DE-627 rakwb rus S1-972 A. S. Blinnik verfasserin aut Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region 2022 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier The study of white lupine samples of grain-forage direction developed by the All-Russian Research Institute of Lupine were carried out for three years (2019–2021) on the fields of the collection farm of the of the department of plant production, breeding and olericulture of the Belgorod State Agrarian University named after V.Ya. Gorin. There have been studied 4 varieties and 26 lines, the variety ‘Michurinsky’ was the standard in the trial. According to the seed productivity in all years of study, most varieties and lines significantly exceeded the standard. On average for 3 years, the most productive lines were ‘SN 17-14’, ‘SN 54-08’ and ‘SN 12–13’, which increase ranged from 43 to 48 % in comparison with the standard variety. Productivity increase from 34 to 39 % was given by the lines ‘SN 816-09’, ‘SN 1735-10’, ‘SN 35-13’ and ‘SN 77-17’. The increase of the varieties ‘Pilgrim’ and ‘Aliy parus’ and four lines ‘SN 18-13’, ‘SN 15-13’, ‘SN 55-14’, ‘SN 138-16’ varied from 21 to 26 % compared to the standard. The variety ‘Timiryazevsky’ and lines ‘SN 1397-10’, ‘SN 78-16’ and ‘SN 25-11’ exceeded the standard on 13–18 %. At the same time, the lines ‘SN 76-16’ and ‘SN 1022-09’ produced the lowest yields, significantly inferior to the standard. The calculation of the adaptability coefficient has shown that the varieties and lines that provided high and stable seed productivity over the years are also highly adaptive to the arid conditions of the region, since this coefficient has exceeded 100 %. The protein percentge in seeds on average for 3 years ranged from 29.55 to 36.45 % with 32.27 % for the standard. Its percentage exceeded 35.0 % among 7 lines and the variety ‘Pilgrim’. The oil content in seeds of the white lupine varieties and lines on average for 3 years ranged from 10.00 to 11.54 %. Most varieties and lines in the trial according to the content of alkaloids in seeds belong to the group of low alkaloids (up to 0.099 %) and medium alkaloids (up to 0.299 %). люпин белый сорта линии урожайность семян стрессоустойчивость компенсаторная способность протеин жир Agriculture (General) M. I. Lukashevich verfasserin aut A. G. Demidova verfasserin aut O. Yu. Artemova verfasserin aut V. N. Naumkin verfasserin aut L. A. Naumkina verfasserin aut In Зерновое хозяйство России Federal State Budgetary Scientific Institution “Agricultural Research Center “Donskoy”", 2019 (2022), 5, Seite 20-25 (DE-627)1760633550 20798733 nnns year:2022 number:5 pages:20-25 https://doi.org/10.31367/2079-8725-2022-82-5-20-25 kostenfrei https://doaj.org/article/241cec8310ba46c5b296a4314ae88efe kostenfrei https://www.zhros.online/jour/article/view/2043 kostenfrei https://doaj.org/toc/2079-8725 Journal toc kostenfrei https://doaj.org/toc/2079-8733 Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 2022 5 20-25 |
| allfieldsGer |
10.31367/2079-8725-2022-82-5-20-25 doi (DE-627)DOAJ088649431 (DE-599)DOAJ241cec8310ba46c5b296a4314ae88efe DE-627 ger DE-627 rakwb rus S1-972 A. S. Blinnik verfasserin aut Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region 2022 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier The study of white lupine samples of grain-forage direction developed by the All-Russian Research Institute of Lupine were carried out for three years (2019–2021) on the fields of the collection farm of the of the department of plant production, breeding and olericulture of the Belgorod State Agrarian University named after V.Ya. Gorin. There have been studied 4 varieties and 26 lines, the variety ‘Michurinsky’ was the standard in the trial. According to the seed productivity in all years of study, most varieties and lines significantly exceeded the standard. On average for 3 years, the most productive lines were ‘SN 17-14’, ‘SN 54-08’ and ‘SN 12–13’, which increase ranged from 43 to 48 % in comparison with the standard variety. Productivity increase from 34 to 39 % was given by the lines ‘SN 816-09’, ‘SN 1735-10’, ‘SN 35-13’ and ‘SN 77-17’. The increase of the varieties ‘Pilgrim’ and ‘Aliy parus’ and four lines ‘SN 18-13’, ‘SN 15-13’, ‘SN 55-14’, ‘SN 138-16’ varied from 21 to 26 % compared to the standard. The variety ‘Timiryazevsky’ and lines ‘SN 1397-10’, ‘SN 78-16’ and ‘SN 25-11’ exceeded the standard on 13–18 %. At the same time, the lines ‘SN 76-16’ and ‘SN 1022-09’ produced the lowest yields, significantly inferior to the standard. The calculation of the adaptability coefficient has shown that the varieties and lines that provided high and stable seed productivity over the years are also highly adaptive to the arid conditions of the region, since this coefficient has exceeded 100 %. The protein percentge in seeds on average for 3 years ranged from 29.55 to 36.45 % with 32.27 % for the standard. Its percentage exceeded 35.0 % among 7 lines and the variety ‘Pilgrim’. The oil content in seeds of the white lupine varieties and lines on average for 3 years ranged from 10.00 to 11.54 %. Most varieties and lines in the trial according to the content of alkaloids in seeds belong to the group of low alkaloids (up to 0.099 %) and medium alkaloids (up to 0.299 %). люпин белый сорта линии урожайность семян стрессоустойчивость компенсаторная способность протеин жир Agriculture (General) M. I. Lukashevich verfasserin aut A. G. Demidova verfasserin aut O. Yu. Artemova verfasserin aut V. N. Naumkin verfasserin aut L. A. Naumkina verfasserin aut In Зерновое хозяйство России Federal State Budgetary Scientific Institution “Agricultural Research Center “Donskoy”", 2019 (2022), 5, Seite 20-25 (DE-627)1760633550 20798733 nnns year:2022 number:5 pages:20-25 https://doi.org/10.31367/2079-8725-2022-82-5-20-25 kostenfrei https://doaj.org/article/241cec8310ba46c5b296a4314ae88efe kostenfrei https://www.zhros.online/jour/article/view/2043 kostenfrei https://doaj.org/toc/2079-8725 Journal toc kostenfrei https://doaj.org/toc/2079-8733 Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 2022 5 20-25 |
| allfieldsSound |
10.31367/2079-8725-2022-82-5-20-25 doi (DE-627)DOAJ088649431 (DE-599)DOAJ241cec8310ba46c5b296a4314ae88efe DE-627 ger DE-627 rakwb rus S1-972 A. S. Blinnik verfasserin aut Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region 2022 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier The study of white lupine samples of grain-forage direction developed by the All-Russian Research Institute of Lupine were carried out for three years (2019–2021) on the fields of the collection farm of the of the department of plant production, breeding and olericulture of the Belgorod State Agrarian University named after V.Ya. Gorin. There have been studied 4 varieties and 26 lines, the variety ‘Michurinsky’ was the standard in the trial. According to the seed productivity in all years of study, most varieties and lines significantly exceeded the standard. On average for 3 years, the most productive lines were ‘SN 17-14’, ‘SN 54-08’ and ‘SN 12–13’, which increase ranged from 43 to 48 % in comparison with the standard variety. Productivity increase from 34 to 39 % was given by the lines ‘SN 816-09’, ‘SN 1735-10’, ‘SN 35-13’ and ‘SN 77-17’. The increase of the varieties ‘Pilgrim’ and ‘Aliy parus’ and four lines ‘SN 18-13’, ‘SN 15-13’, ‘SN 55-14’, ‘SN 138-16’ varied from 21 to 26 % compared to the standard. The variety ‘Timiryazevsky’ and lines ‘SN 1397-10’, ‘SN 78-16’ and ‘SN 25-11’ exceeded the standard on 13–18 %. At the same time, the lines ‘SN 76-16’ and ‘SN 1022-09’ produced the lowest yields, significantly inferior to the standard. The calculation of the adaptability coefficient has shown that the varieties and lines that provided high and stable seed productivity over the years are also highly adaptive to the arid conditions of the region, since this coefficient has exceeded 100 %. The protein percentge in seeds on average for 3 years ranged from 29.55 to 36.45 % with 32.27 % for the standard. Its percentage exceeded 35.0 % among 7 lines and the variety ‘Pilgrim’. The oil content in seeds of the white lupine varieties and lines on average for 3 years ranged from 10.00 to 11.54 %. Most varieties and lines in the trial according to the content of alkaloids in seeds belong to the group of low alkaloids (up to 0.099 %) and medium alkaloids (up to 0.299 %). люпин белый сорта линии урожайность семян стрессоустойчивость компенсаторная способность протеин жир Agriculture (General) M. I. Lukashevich verfasserin aut A. G. Demidova verfasserin aut O. Yu. Artemova verfasserin aut V. N. Naumkin verfasserin aut L. A. Naumkina verfasserin aut In Зерновое хозяйство России Federal State Budgetary Scientific Institution “Agricultural Research Center “Donskoy”", 2019 (2022), 5, Seite 20-25 (DE-627)1760633550 20798733 nnns year:2022 number:5 pages:20-25 https://doi.org/10.31367/2079-8725-2022-82-5-20-25 kostenfrei https://doaj.org/article/241cec8310ba46c5b296a4314ae88efe kostenfrei https://www.zhros.online/jour/article/view/2043 kostenfrei https://doaj.org/toc/2079-8725 Journal toc kostenfrei https://doaj.org/toc/2079-8733 Journal toc kostenfrei GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ AR 2022 5 20-25 |
| language |
Russian |
| source |
In Зерновое хозяйство России (2022), 5, Seite 20-25 year:2022 number:5 pages:20-25 |
| sourceStr |
In Зерновое хозяйство России (2022), 5, Seite 20-25 year:2022 number:5 pages:20-25 |
| format_phy_str_mv |
Article |
| institution |
findex.gbv.de |
| topic_facet |
люпин белый сорта линии урожайность семян стрессоустойчивость компенсаторная способность протеин жир Agriculture (General) |
| isfreeaccess_bool |
true |
| container_title |
Зерновое хозяйство России |
| authorswithroles_txt_mv |
A. S. Blinnik @@aut@@ M. I. Lukashevich @@aut@@ A. G. Demidova @@aut@@ O. Yu. Artemova @@aut@@ V. N. Naumkin @@aut@@ L. A. Naumkina @@aut@@ |
| publishDateDaySort_date |
2022-01-01T00:00:00Z |
| hierarchy_top_id |
1760633550 |
| id |
DOAJ088649431 |
| language_de |
russisch |
| fullrecord |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000naa a22002652 4500</leader><controlfield tag="001">DOAJ088649431</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230410114631.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">230410s2022 xx |||||o 00| ||rus c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.31367/2079-8725-2022-82-5-20-25</subfield><subfield code="2">doi</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)DOAJ088649431</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)DOAJ241cec8310ba46c5b296a4314ae88efe</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">rus</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">S1-972</subfield></datafield><datafield tag="100" ind1="0" ind2=" "><subfield code="a">A. S. Blinnik</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2022</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">Text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">Computermedien</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">Online-Ressource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">The study of white lupine samples of grain-forage direction developed by the All-Russian Research Institute of Lupine were carried out for three years (2019–2021) on the fields of the collection farm of the of the department of plant production, breeding and olericulture of the Belgorod State Agrarian University named after V.Ya. Gorin. There have been studied 4 varieties and 26 lines, the variety ‘Michurinsky’ was the standard in the trial. According to the seed productivity in all years of study, most varieties and lines significantly exceeded the standard. On average for 3 years, the most productive lines were ‘SN 17-14’, ‘SN 54-08’ and ‘SN 12–13’, which increase ranged from 43 to 48 % in comparison with the standard variety. Productivity increase from 34 to 39 % was given by the lines ‘SN 816-09’, ‘SN 1735-10’, ‘SN 35-13’ and ‘SN 77-17’. The increase of the varieties ‘Pilgrim’ and ‘Aliy parus’ and four lines ‘SN 18-13’, ‘SN 15-13’, ‘SN 55-14’, ‘SN 138-16’ varied from 21 to 26 % compared to the standard. The variety ‘Timiryazevsky’ and lines ‘SN 1397-10’, ‘SN 78-16’ and ‘SN 25-11’ exceeded the standard on 13–18 %. At the same time, the lines ‘SN 76-16’ and ‘SN 1022-09’ produced the lowest yields, significantly inferior to the standard. The calculation of the adaptability coefficient has shown that the varieties and lines that provided high and stable seed productivity over the years are also highly adaptive to the arid conditions of the region, since this coefficient has exceeded 100 %. The protein percentge in seeds on average for 3 years ranged from 29.55 to 36.45 % with 32.27 % for the standard. Its percentage exceeded 35.0 % among 7 lines and the variety ‘Pilgrim’. The oil content in seeds of the white lupine varieties and lines on average for 3 years ranged from 10.00 to 11.54 %. Most varieties and lines in the trial according to the content of alkaloids in seeds belong to the group of low alkaloids (up to 0.099 %) and medium alkaloids (up to 0.299 %).</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">люпин белый</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">сорта</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">линии</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">урожайность семян</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">стрессоустойчивость</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">компенсаторная способность</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">протеин</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">жир</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Agriculture (General)</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">M. I. Lukashevich</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">A. G. Demidova</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">O. Yu. Artemova</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">V. N. Naumkin</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">L. A. Naumkina</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">In</subfield><subfield code="t">Зерновое хозяйство России</subfield><subfield code="d">Federal State Budgetary Scientific Institution “Agricultural Research Center “Donskoy”", 2019</subfield><subfield code="g">(2022), 5, Seite 20-25</subfield><subfield code="w">(DE-627)1760633550</subfield><subfield code="x">20798733</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">year:2022</subfield><subfield code="g">number:5</subfield><subfield code="g">pages:20-25</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.31367/2079-8725-2022-82-5-20-25</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doaj.org/article/241cec8310ba46c5b296a4314ae88efe</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://www.zhros.online/jour/article/view/2043</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/2079-8725</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/2079-8733</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_DOAJ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="j">2022</subfield><subfield code="e">5</subfield><subfield code="h">20-25</subfield></datafield></record></collection>
|
| callnumber-first |
S - Agriculture |
| author |
A. S. Blinnik |
| spellingShingle |
A. S. Blinnik misc S1-972 misc люпин белый misc сорта misc линии misc урожайность семян misc стрессоустойчивость misc компенсаторная способность misc протеин misc жир misc Agriculture (General) Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region |
| authorStr |
A. S. Blinnik |
| ppnlink_with_tag_str_mv |
@@773@@(DE-627)1760633550 |
| format |
electronic Article |
| delete_txt_mv |
keep |
| author_role |
aut aut aut aut aut aut |
| collection |
DOAJ |
| remote_str |
true |
| callnumber-label |
S1-972 |
| illustrated |
Not Illustrated |
| issn |
20798733 |
| topic_title |
S1-972 Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region люпин белый сорта линии урожайность семян стрессоустойчивость компенсаторная способность протеин жир |
| topic |
misc S1-972 misc люпин белый misc сорта misc линии misc урожайность семян misc стрессоустойчивость misc компенсаторная способность misc протеин misc жир misc Agriculture (General) |
| topic_unstemmed |
misc S1-972 misc люпин белый misc сорта misc линии misc урожайность семян misc стрессоустойчивость misc компенсаторная способность misc протеин misc жир misc Agriculture (General) |
| topic_browse |
misc S1-972 misc люпин белый misc сорта misc линии misc урожайность семян misc стрессоустойчивость misc компенсаторная способность misc протеин misc жир misc Agriculture (General) |
| format_facet |
Elektronische Aufsätze Aufsätze Elektronische Ressource |
| format_main_str_mv |
Text Zeitschrift/Artikel |
| carriertype_str_mv |
cr |
| hierarchy_parent_title |
Зерновое хозяйство России |
| hierarchy_parent_id |
1760633550 |
| hierarchy_top_title |
Зерновое хозяйство России |
| isfreeaccess_txt |
true |
| familylinks_str_mv |
(DE-627)1760633550 |
| title |
Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region |
| ctrlnum |
(DE-627)DOAJ088649431 (DE-599)DOAJ241cec8310ba46c5b296a4314ae88efe |
| title_full |
Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region |
| author_sort |
A. S. Blinnik |
| journal |
Зерновое хозяйство России |
| journalStr |
Зерновое хозяйство России |
| callnumber-first-code |
S |
| lang_code |
rus |
| isOA_bool |
true |
| recordtype |
marc |
| publishDateSort |
2022 |
| contenttype_str_mv |
txt |
| container_start_page |
20 |
| author_browse |
A. S. Blinnik M. I. Lukashevich A. G. Demidova O. Yu. Artemova V. N. Naumkin L. A. Naumkina |
| class |
S1-972 |
| format_se |
Elektronische Aufsätze |
| author-letter |
A. S. Blinnik |
| doi_str_mv |
10.31367/2079-8725-2022-82-5-20-25 |
| author2-role |
verfasserin |
| title_sort |
productivity and seed quality of the new white lupine varieties and lines in the central black-earth region |
| callnumber |
S1-972 |
| title_auth |
Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region |
| abstract |
The study of white lupine samples of grain-forage direction developed by the All-Russian Research Institute of Lupine were carried out for three years (2019–2021) on the fields of the collection farm of the of the department of plant production, breeding and olericulture of the Belgorod State Agrarian University named after V.Ya. Gorin. There have been studied 4 varieties and 26 lines, the variety ‘Michurinsky’ was the standard in the trial. According to the seed productivity in all years of study, most varieties and lines significantly exceeded the standard. On average for 3 years, the most productive lines were ‘SN 17-14’, ‘SN 54-08’ and ‘SN 12–13’, which increase ranged from 43 to 48 % in comparison with the standard variety. Productivity increase from 34 to 39 % was given by the lines ‘SN 816-09’, ‘SN 1735-10’, ‘SN 35-13’ and ‘SN 77-17’. The increase of the varieties ‘Pilgrim’ and ‘Aliy parus’ and four lines ‘SN 18-13’, ‘SN 15-13’, ‘SN 55-14’, ‘SN 138-16’ varied from 21 to 26 % compared to the standard. The variety ‘Timiryazevsky’ and lines ‘SN 1397-10’, ‘SN 78-16’ and ‘SN 25-11’ exceeded the standard on 13–18 %. At the same time, the lines ‘SN 76-16’ and ‘SN 1022-09’ produced the lowest yields, significantly inferior to the standard. The calculation of the adaptability coefficient has shown that the varieties and lines that provided high and stable seed productivity over the years are also highly adaptive to the arid conditions of the region, since this coefficient has exceeded 100 %. The protein percentge in seeds on average for 3 years ranged from 29.55 to 36.45 % with 32.27 % for the standard. Its percentage exceeded 35.0 % among 7 lines and the variety ‘Pilgrim’. The oil content in seeds of the white lupine varieties and lines on average for 3 years ranged from 10.00 to 11.54 %. Most varieties and lines in the trial according to the content of alkaloids in seeds belong to the group of low alkaloids (up to 0.099 %) and medium alkaloids (up to 0.299 %). |
| abstractGer |
The study of white lupine samples of grain-forage direction developed by the All-Russian Research Institute of Lupine were carried out for three years (2019–2021) on the fields of the collection farm of the of the department of plant production, breeding and olericulture of the Belgorod State Agrarian University named after V.Ya. Gorin. There have been studied 4 varieties and 26 lines, the variety ‘Michurinsky’ was the standard in the trial. According to the seed productivity in all years of study, most varieties and lines significantly exceeded the standard. On average for 3 years, the most productive lines were ‘SN 17-14’, ‘SN 54-08’ and ‘SN 12–13’, which increase ranged from 43 to 48 % in comparison with the standard variety. Productivity increase from 34 to 39 % was given by the lines ‘SN 816-09’, ‘SN 1735-10’, ‘SN 35-13’ and ‘SN 77-17’. The increase of the varieties ‘Pilgrim’ and ‘Aliy parus’ and four lines ‘SN 18-13’, ‘SN 15-13’, ‘SN 55-14’, ‘SN 138-16’ varied from 21 to 26 % compared to the standard. The variety ‘Timiryazevsky’ and lines ‘SN 1397-10’, ‘SN 78-16’ and ‘SN 25-11’ exceeded the standard on 13–18 %. At the same time, the lines ‘SN 76-16’ and ‘SN 1022-09’ produced the lowest yields, significantly inferior to the standard. The calculation of the adaptability coefficient has shown that the varieties and lines that provided high and stable seed productivity over the years are also highly adaptive to the arid conditions of the region, since this coefficient has exceeded 100 %. The protein percentge in seeds on average for 3 years ranged from 29.55 to 36.45 % with 32.27 % for the standard. Its percentage exceeded 35.0 % among 7 lines and the variety ‘Pilgrim’. The oil content in seeds of the white lupine varieties and lines on average for 3 years ranged from 10.00 to 11.54 %. Most varieties and lines in the trial according to the content of alkaloids in seeds belong to the group of low alkaloids (up to 0.099 %) and medium alkaloids (up to 0.299 %). |
| abstract_unstemmed |
The study of white lupine samples of grain-forage direction developed by the All-Russian Research Institute of Lupine were carried out for three years (2019–2021) on the fields of the collection farm of the of the department of plant production, breeding and olericulture of the Belgorod State Agrarian University named after V.Ya. Gorin. There have been studied 4 varieties and 26 lines, the variety ‘Michurinsky’ was the standard in the trial. According to the seed productivity in all years of study, most varieties and lines significantly exceeded the standard. On average for 3 years, the most productive lines were ‘SN 17-14’, ‘SN 54-08’ and ‘SN 12–13’, which increase ranged from 43 to 48 % in comparison with the standard variety. Productivity increase from 34 to 39 % was given by the lines ‘SN 816-09’, ‘SN 1735-10’, ‘SN 35-13’ and ‘SN 77-17’. The increase of the varieties ‘Pilgrim’ and ‘Aliy parus’ and four lines ‘SN 18-13’, ‘SN 15-13’, ‘SN 55-14’, ‘SN 138-16’ varied from 21 to 26 % compared to the standard. The variety ‘Timiryazevsky’ and lines ‘SN 1397-10’, ‘SN 78-16’ and ‘SN 25-11’ exceeded the standard on 13–18 %. At the same time, the lines ‘SN 76-16’ and ‘SN 1022-09’ produced the lowest yields, significantly inferior to the standard. The calculation of the adaptability coefficient has shown that the varieties and lines that provided high and stable seed productivity over the years are also highly adaptive to the arid conditions of the region, since this coefficient has exceeded 100 %. The protein percentge in seeds on average for 3 years ranged from 29.55 to 36.45 % with 32.27 % for the standard. Its percentage exceeded 35.0 % among 7 lines and the variety ‘Pilgrim’. The oil content in seeds of the white lupine varieties and lines on average for 3 years ranged from 10.00 to 11.54 %. Most varieties and lines in the trial according to the content of alkaloids in seeds belong to the group of low alkaloids (up to 0.099 %) and medium alkaloids (up to 0.299 %). |
| collection_details |
GBV_USEFLAG_A SYSFLAG_A GBV_DOAJ |
| container_issue |
5 |
| title_short |
Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region |
| url |
https://doi.org/10.31367/2079-8725-2022-82-5-20-25 https://doaj.org/article/241cec8310ba46c5b296a4314ae88efe https://www.zhros.online/jour/article/view/2043 https://doaj.org/toc/2079-8725 https://doaj.org/toc/2079-8733 |
| remote_bool |
true |
| author2 |
M. I. Lukashevich A. G. Demidova O. Yu. Artemova V. N. Naumkin L. A. Naumkina |
| author2Str |
M. I. Lukashevich A. G. Demidova O. Yu. Artemova V. N. Naumkin L. A. Naumkina |
| ppnlink |
1760633550 |
| callnumber-subject |
S - General Agriculture |
| mediatype_str_mv |
c |
| isOA_txt |
true |
| hochschulschrift_bool |
false |
| doi_str |
10.31367/2079-8725-2022-82-5-20-25 |
| callnumber-a |
S1-972 |
| up_date |
2024-07-03T18:49:44.383Z |
| _version_ |
1803584887210377216 |
| fullrecord_marcxml |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000naa a22002652 4500</leader><controlfield tag="001">DOAJ088649431</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230410114631.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">230410s2022 xx |||||o 00| ||rus c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.31367/2079-8725-2022-82-5-20-25</subfield><subfield code="2">doi</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)DOAJ088649431</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)DOAJ241cec8310ba46c5b296a4314ae88efe</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">rus</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">S1-972</subfield></datafield><datafield tag="100" ind1="0" ind2=" "><subfield code="a">A. S. Blinnik</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Productivity and seed quality of the new white lupine varieties and lines in the Central Black-Earth region</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2022</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">Text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">Computermedien</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">Online-Ressource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">The study of white lupine samples of grain-forage direction developed by the All-Russian Research Institute of Lupine were carried out for three years (2019–2021) on the fields of the collection farm of the of the department of plant production, breeding and olericulture of the Belgorod State Agrarian University named after V.Ya. Gorin. There have been studied 4 varieties and 26 lines, the variety ‘Michurinsky’ was the standard in the trial. According to the seed productivity in all years of study, most varieties and lines significantly exceeded the standard. On average for 3 years, the most productive lines were ‘SN 17-14’, ‘SN 54-08’ and ‘SN 12–13’, which increase ranged from 43 to 48 % in comparison with the standard variety. Productivity increase from 34 to 39 % was given by the lines ‘SN 816-09’, ‘SN 1735-10’, ‘SN 35-13’ and ‘SN 77-17’. The increase of the varieties ‘Pilgrim’ and ‘Aliy parus’ and four lines ‘SN 18-13’, ‘SN 15-13’, ‘SN 55-14’, ‘SN 138-16’ varied from 21 to 26 % compared to the standard. The variety ‘Timiryazevsky’ and lines ‘SN 1397-10’, ‘SN 78-16’ and ‘SN 25-11’ exceeded the standard on 13–18 %. At the same time, the lines ‘SN 76-16’ and ‘SN 1022-09’ produced the lowest yields, significantly inferior to the standard. The calculation of the adaptability coefficient has shown that the varieties and lines that provided high and stable seed productivity over the years are also highly adaptive to the arid conditions of the region, since this coefficient has exceeded 100 %. The protein percentge in seeds on average for 3 years ranged from 29.55 to 36.45 % with 32.27 % for the standard. Its percentage exceeded 35.0 % among 7 lines and the variety ‘Pilgrim’. The oil content in seeds of the white lupine varieties and lines on average for 3 years ranged from 10.00 to 11.54 %. Most varieties and lines in the trial according to the content of alkaloids in seeds belong to the group of low alkaloids (up to 0.099 %) and medium alkaloids (up to 0.299 %).</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">люпин белый</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">сорта</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">линии</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">урожайность семян</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">стрессоустойчивость</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">компенсаторная способность</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">протеин</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">жир</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Agriculture (General)</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">M. I. Lukashevich</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">A. G. Demidova</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">O. Yu. Artemova</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">V. N. Naumkin</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="0" ind2=" "><subfield code="a">L. A. Naumkina</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">In</subfield><subfield code="t">Зерновое хозяйство России</subfield><subfield code="d">Federal State Budgetary Scientific Institution “Agricultural Research Center “Donskoy”", 2019</subfield><subfield code="g">(2022), 5, Seite 20-25</subfield><subfield code="w">(DE-627)1760633550</subfield><subfield code="x">20798733</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">year:2022</subfield><subfield code="g">number:5</subfield><subfield code="g">pages:20-25</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.31367/2079-8725-2022-82-5-20-25</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doaj.org/article/241cec8310ba46c5b296a4314ae88efe</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://www.zhros.online/jour/article/view/2043</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/2079-8725</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://doaj.org/toc/2079-8733</subfield><subfield code="y">Journal toc</subfield><subfield code="z">kostenfrei</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_DOAJ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="j">2022</subfield><subfield code="e">5</subfield><subfield code="h">20-25</subfield></datafield></record></collection>
|
| score |
7.39935 |