Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women
• LIAISON® IgG Avidity II and VIDAS® II CMV IgG Avidity assays were compared. • Correlation between the 2 assays was 77% in 280 sera with positive IgM. • The LIAISON® assay reached more rapidly higher avidity status than the VIDAS® assay. • The LIAISON® assay missed the diagnosis of primary infectio...
Ausführliche Beschreibung
Gespeichert in:
| Autor*in: |
Sellier, Yann [verfasserIn] |
|---|
| Format: |
E-Artikel |
|---|---|
| Sprache: |
Englisch |
| Erschienen: |
2015 |
|---|
| Schlagwörter: |
|---|
| Umfang: |
3 |
|---|
| Übergeordnetes Werk: |
Enthalten in: Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management - Scheen, Marc ELSEVIER, 2022, Amsterdam [u.a.] |
|---|---|
| Übergeordnetes Werk: |
volume:72 ; year:2015 ; pages:46-48 ; extent:3 |
| Links: |
|---|
| DOI / URN: |
10.1016/j.jcv.2015.08.018 |
|---|
| Katalog-ID: |
ELV018216323 |
|---|
| LEADER | 01000caa a22002652 4500 | ||
|---|---|---|---|
| 001 | ELV018216323 | ||
| 003 | DE-627 | ||
| 005 | 20230623142520.0 | ||
| 007 | cr uuu---uuuuu | ||
| 008 | 180602s2015 xx |||||o 00| ||eng c | ||
| 024 | 7 | |a 10.1016/j.jcv.2015.08.018 |2 doi | |
| 028 | 5 | 2 | |a GBVA2015003000004.pica |
| 035 | |a (DE-627)ELV018216323 | ||
| 035 | |a (ELSEVIER)S1386-6532(15)00653-8 | ||
| 040 | |a DE-627 |b ger |c DE-627 |e rakwb | ||
| 041 | |a eng | ||
| 082 | 0 | |a 610 | |
| 082 | 0 | 4 | |a 610 |q DE-600 |
| 082 | 0 | 4 | |a 616.019405 |q OCLC |
| 082 | 0 | 4 | |a 610 |q VZ |
| 084 | |a 44.45 |2 bkl | ||
| 100 | 1 | |a Sellier, Yann |e verfasserin |4 aut | |
| 245 | 1 | 0 | |a Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women |
| 264 | 1 | |c 2015 | |
| 300 | |a 3 | ||
| 336 | |a nicht spezifiziert |b zzz |2 rdacontent | ||
| 337 | |a nicht spezifiziert |b z |2 rdamedia | ||
| 338 | |a nicht spezifiziert |b zu |2 rdacarrier | ||
| 520 | |a • LIAISON® IgG Avidity II and VIDAS® II CMV IgG Avidity assays were compared. • Correlation between the 2 assays was 77% in 280 sera with positive IgM. • The LIAISON® assay reached more rapidly higher avidity status than the VIDAS® assay. • The LIAISON® assay missed the diagnosis of primary infection in 4 sera with low IgG. | ||
| 650 | 7 | |a Cytomegalovirus |2 Elsevier | |
| 650 | 7 | |a IgG avidity |2 Elsevier | |
| 650 | 7 | |a Primary infection |2 Elsevier | |
| 650 | 7 | |a LIAISON |2 Elsevier | |
| 650 | 7 | |a VIDAS |2 Elsevier | |
| 700 | 1 | |a Guilleminot, Tiffany |4 oth | |
| 700 | 1 | |a Ville, Yves |4 oth | |
| 700 | 1 | |a Leruez-Ville, Marianne |4 oth | |
| 773 | 0 | 8 | |i Enthalten in |n Elsevier Science |a Scheen, Marc ELSEVIER |t Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management |d 2022 |g Amsterdam [u.a.] |w (DE-627)ELV007727844 |
| 773 | 1 | 8 | |g volume:72 |g year:2015 |g pages:46-48 |g extent:3 |
| 856 | 4 | 0 | |u https://doi.org/10.1016/j.jcv.2015.08.018 |3 Volltext |
| 912 | |a GBV_USEFLAG_U | ||
| 912 | |a GBV_ELV | ||
| 912 | |a SYSFLAG_U | ||
| 912 | |a SSG-OLC-PHA | ||
| 936 | b | k | |a 44.45 |j Immunologie |q VZ |
| 951 | |a AR | ||
| 952 | |d 72 |j 2015 |h 46-48 |g 3 | ||
| 953 | |2 045F |a 610 | ||
| author_variant |
y s ys |
|---|---|
| matchkey_str |
sellieryannguilleminottiffanyvilleyvesle:2015----:oprsnfhlasnmigvdtiadhvdsmigvdtiasyfrhdanssf |
| hierarchy_sort_str |
2015 |
| bklnumber |
44.45 |
| publishDate |
2015 |
| allfields |
10.1016/j.jcv.2015.08.018 doi GBVA2015003000004.pica (DE-627)ELV018216323 (ELSEVIER)S1386-6532(15)00653-8 DE-627 ger DE-627 rakwb eng 610 610 DE-600 616.019405 OCLC 610 VZ 44.45 bkl Sellier, Yann verfasserin aut Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women 2015 3 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • LIAISON® IgG Avidity II and VIDAS® II CMV IgG Avidity assays were compared. • Correlation between the 2 assays was 77% in 280 sera with positive IgM. • The LIAISON® assay reached more rapidly higher avidity status than the VIDAS® assay. • The LIAISON® assay missed the diagnosis of primary infection in 4 sera with low IgG. Cytomegalovirus Elsevier IgG avidity Elsevier Primary infection Elsevier LIAISON Elsevier VIDAS Elsevier Guilleminot, Tiffany oth Ville, Yves oth Leruez-Ville, Marianne oth Enthalten in Elsevier Science Scheen, Marc ELSEVIER Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management 2022 Amsterdam [u.a.] (DE-627)ELV007727844 volume:72 year:2015 pages:46-48 extent:3 https://doi.org/10.1016/j.jcv.2015.08.018 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U SSG-OLC-PHA 44.45 Immunologie VZ AR 72 2015 46-48 3 045F 610 |
| spelling |
10.1016/j.jcv.2015.08.018 doi GBVA2015003000004.pica (DE-627)ELV018216323 (ELSEVIER)S1386-6532(15)00653-8 DE-627 ger DE-627 rakwb eng 610 610 DE-600 616.019405 OCLC 610 VZ 44.45 bkl Sellier, Yann verfasserin aut Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women 2015 3 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • LIAISON® IgG Avidity II and VIDAS® II CMV IgG Avidity assays were compared. • Correlation between the 2 assays was 77% in 280 sera with positive IgM. • The LIAISON® assay reached more rapidly higher avidity status than the VIDAS® assay. • The LIAISON® assay missed the diagnosis of primary infection in 4 sera with low IgG. Cytomegalovirus Elsevier IgG avidity Elsevier Primary infection Elsevier LIAISON Elsevier VIDAS Elsevier Guilleminot, Tiffany oth Ville, Yves oth Leruez-Ville, Marianne oth Enthalten in Elsevier Science Scheen, Marc ELSEVIER Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management 2022 Amsterdam [u.a.] (DE-627)ELV007727844 volume:72 year:2015 pages:46-48 extent:3 https://doi.org/10.1016/j.jcv.2015.08.018 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U SSG-OLC-PHA 44.45 Immunologie VZ AR 72 2015 46-48 3 045F 610 |
| allfields_unstemmed |
10.1016/j.jcv.2015.08.018 doi GBVA2015003000004.pica (DE-627)ELV018216323 (ELSEVIER)S1386-6532(15)00653-8 DE-627 ger DE-627 rakwb eng 610 610 DE-600 616.019405 OCLC 610 VZ 44.45 bkl Sellier, Yann verfasserin aut Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women 2015 3 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • LIAISON® IgG Avidity II and VIDAS® II CMV IgG Avidity assays were compared. • Correlation between the 2 assays was 77% in 280 sera with positive IgM. • The LIAISON® assay reached more rapidly higher avidity status than the VIDAS® assay. • The LIAISON® assay missed the diagnosis of primary infection in 4 sera with low IgG. Cytomegalovirus Elsevier IgG avidity Elsevier Primary infection Elsevier LIAISON Elsevier VIDAS Elsevier Guilleminot, Tiffany oth Ville, Yves oth Leruez-Ville, Marianne oth Enthalten in Elsevier Science Scheen, Marc ELSEVIER Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management 2022 Amsterdam [u.a.] (DE-627)ELV007727844 volume:72 year:2015 pages:46-48 extent:3 https://doi.org/10.1016/j.jcv.2015.08.018 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U SSG-OLC-PHA 44.45 Immunologie VZ AR 72 2015 46-48 3 045F 610 |
| allfieldsGer |
10.1016/j.jcv.2015.08.018 doi GBVA2015003000004.pica (DE-627)ELV018216323 (ELSEVIER)S1386-6532(15)00653-8 DE-627 ger DE-627 rakwb eng 610 610 DE-600 616.019405 OCLC 610 VZ 44.45 bkl Sellier, Yann verfasserin aut Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women 2015 3 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • LIAISON® IgG Avidity II and VIDAS® II CMV IgG Avidity assays were compared. • Correlation between the 2 assays was 77% in 280 sera with positive IgM. • The LIAISON® assay reached more rapidly higher avidity status than the VIDAS® assay. • The LIAISON® assay missed the diagnosis of primary infection in 4 sera with low IgG. Cytomegalovirus Elsevier IgG avidity Elsevier Primary infection Elsevier LIAISON Elsevier VIDAS Elsevier Guilleminot, Tiffany oth Ville, Yves oth Leruez-Ville, Marianne oth Enthalten in Elsevier Science Scheen, Marc ELSEVIER Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management 2022 Amsterdam [u.a.] (DE-627)ELV007727844 volume:72 year:2015 pages:46-48 extent:3 https://doi.org/10.1016/j.jcv.2015.08.018 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U SSG-OLC-PHA 44.45 Immunologie VZ AR 72 2015 46-48 3 045F 610 |
| allfieldsSound |
10.1016/j.jcv.2015.08.018 doi GBVA2015003000004.pica (DE-627)ELV018216323 (ELSEVIER)S1386-6532(15)00653-8 DE-627 ger DE-627 rakwb eng 610 610 DE-600 616.019405 OCLC 610 VZ 44.45 bkl Sellier, Yann verfasserin aut Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women 2015 3 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • LIAISON® IgG Avidity II and VIDAS® II CMV IgG Avidity assays were compared. • Correlation between the 2 assays was 77% in 280 sera with positive IgM. • The LIAISON® assay reached more rapidly higher avidity status than the VIDAS® assay. • The LIAISON® assay missed the diagnosis of primary infection in 4 sera with low IgG. Cytomegalovirus Elsevier IgG avidity Elsevier Primary infection Elsevier LIAISON Elsevier VIDAS Elsevier Guilleminot, Tiffany oth Ville, Yves oth Leruez-Ville, Marianne oth Enthalten in Elsevier Science Scheen, Marc ELSEVIER Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management 2022 Amsterdam [u.a.] (DE-627)ELV007727844 volume:72 year:2015 pages:46-48 extent:3 https://doi.org/10.1016/j.jcv.2015.08.018 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U SSG-OLC-PHA 44.45 Immunologie VZ AR 72 2015 46-48 3 045F 610 |
| language |
English |
| source |
Enthalten in Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management Amsterdam [u.a.] volume:72 year:2015 pages:46-48 extent:3 |
| sourceStr |
Enthalten in Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management Amsterdam [u.a.] volume:72 year:2015 pages:46-48 extent:3 |
| format_phy_str_mv |
Article |
| bklname |
Immunologie |
| institution |
findex.gbv.de |
| topic_facet |
Cytomegalovirus IgG avidity Primary infection LIAISON VIDAS |
| dewey-raw |
610 |
| isfreeaccess_bool |
false |
| container_title |
Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management |
| authorswithroles_txt_mv |
Sellier, Yann @@aut@@ Guilleminot, Tiffany @@oth@@ Ville, Yves @@oth@@ Leruez-Ville, Marianne @@oth@@ |
| publishDateDaySort_date |
2015-01-01T00:00:00Z |
| hierarchy_top_id |
ELV007727844 |
| dewey-sort |
3610 |
| id |
ELV018216323 |
| language_de |
englisch |
| fullrecord |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">ELV018216323</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230623142520.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">180602s2015 xx |||||o 00| ||eng c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1016/j.jcv.2015.08.018</subfield><subfield code="2">doi</subfield></datafield><datafield tag="028" ind1="5" ind2="2"><subfield code="a">GBVA2015003000004.pica</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)ELV018216323</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ELSEVIER)S1386-6532(15)00653-8</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">610</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">610</subfield><subfield code="q">DE-600</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">616.019405</subfield><subfield code="q">OCLC</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">610</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">44.45</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Sellier, Yann</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2015</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">3</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zzz</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">z</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zu</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">• LIAISON® IgG Avidity II and VIDAS® II CMV IgG Avidity assays were compared. • Correlation between the 2 assays was 77% in 280 sera with positive IgM. • The LIAISON® assay reached more rapidly higher avidity status than the VIDAS® assay. • The LIAISON® assay missed the diagnosis of primary infection in 4 sera with low IgG.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Cytomegalovirus</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">IgG avidity</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Primary infection</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">LIAISON</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">VIDAS</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Guilleminot, Tiffany</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Ville, Yves</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Leruez-Ville, Marianne</subfield><subfield code="4">oth</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">Enthalten in</subfield><subfield code="n">Elsevier Science</subfield><subfield code="a">Scheen, Marc ELSEVIER</subfield><subfield code="t">Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management</subfield><subfield code="d">2022</subfield><subfield code="g">Amsterdam [u.a.]</subfield><subfield code="w">(DE-627)ELV007727844</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:72</subfield><subfield code="g">year:2015</subfield><subfield code="g">pages:46-48</subfield><subfield code="g">extent:3</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.1016/j.jcv.2015.08.018</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ELV</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SSG-OLC-PHA</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">44.45</subfield><subfield code="j">Immunologie</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">72</subfield><subfield code="j">2015</subfield><subfield code="h">46-48</subfield><subfield code="g">3</subfield></datafield><datafield tag="953" ind1=" " ind2=" "><subfield code="2">045F</subfield><subfield code="a">610</subfield></datafield></record></collection>
|
| author |
Sellier, Yann |
| spellingShingle |
Sellier, Yann ddc 610 ddc 616.019405 bkl 44.45 Elsevier Cytomegalovirus Elsevier IgG avidity Elsevier Primary infection Elsevier LIAISON Elsevier VIDAS Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women |
| authorStr |
Sellier, Yann |
| ppnlink_with_tag_str_mv |
@@773@@(DE-627)ELV007727844 |
| format |
electronic Article |
| dewey-ones |
610 - Medicine & health 616 - Diseases |
| delete_txt_mv |
keep |
| author_role |
aut |
| collection |
elsevier |
| remote_str |
true |
| illustrated |
Not Illustrated |
| topic_title |
610 610 DE-600 616.019405 OCLC 610 VZ 44.45 bkl Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women Cytomegalovirus Elsevier IgG avidity Elsevier Primary infection Elsevier LIAISON Elsevier VIDAS Elsevier |
| topic |
ddc 610 ddc 616.019405 bkl 44.45 Elsevier Cytomegalovirus Elsevier IgG avidity Elsevier Primary infection Elsevier LIAISON Elsevier VIDAS |
| topic_unstemmed |
ddc 610 ddc 616.019405 bkl 44.45 Elsevier Cytomegalovirus Elsevier IgG avidity Elsevier Primary infection Elsevier LIAISON Elsevier VIDAS |
| topic_browse |
ddc 610 ddc 616.019405 bkl 44.45 Elsevier Cytomegalovirus Elsevier IgG avidity Elsevier Primary infection Elsevier LIAISON Elsevier VIDAS |
| format_facet |
Elektronische Aufsätze Aufsätze Elektronische Ressource |
| format_main_str_mv |
Text Zeitschrift/Artikel |
| carriertype_str_mv |
zu |
| author2_variant |
t g tg y v yv m l v mlv |
| hierarchy_parent_title |
Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management |
| hierarchy_parent_id |
ELV007727844 |
| dewey-tens |
610 - Medicine & health |
| hierarchy_top_title |
Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management |
| isfreeaccess_txt |
false |
| familylinks_str_mv |
(DE-627)ELV007727844 |
| title |
Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women |
| ctrlnum |
(DE-627)ELV018216323 (ELSEVIER)S1386-6532(15)00653-8 |
| title_full |
Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women |
| author_sort |
Sellier, Yann |
| journal |
Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management |
| journalStr |
Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management |
| lang_code |
eng |
| isOA_bool |
false |
| dewey-hundreds |
600 - Technology |
| recordtype |
marc |
| publishDateSort |
2015 |
| contenttype_str_mv |
zzz |
| container_start_page |
46 |
| author_browse |
Sellier, Yann |
| container_volume |
72 |
| physical |
3 |
| class |
610 610 DE-600 616.019405 OCLC 610 VZ 44.45 bkl |
| format_se |
Elektronische Aufsätze |
| author-letter |
Sellier, Yann |
| doi_str_mv |
10.1016/j.jcv.2015.08.018 |
| dewey-full |
610 616.019405 |
| title_sort |
comparison of the liaison® cmv igg avidity ii and the vidas® cmv igg avidity ii assays for the diagnosis of primary infection in pregnant women |
| title_auth |
Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women |
| abstract |
• LIAISON® IgG Avidity II and VIDAS® II CMV IgG Avidity assays were compared. • Correlation between the 2 assays was 77% in 280 sera with positive IgM. • The LIAISON® assay reached more rapidly higher avidity status than the VIDAS® assay. • The LIAISON® assay missed the diagnosis of primary infection in 4 sera with low IgG. |
| abstractGer |
• LIAISON® IgG Avidity II and VIDAS® II CMV IgG Avidity assays were compared. • Correlation between the 2 assays was 77% in 280 sera with positive IgM. • The LIAISON® assay reached more rapidly higher avidity status than the VIDAS® assay. • The LIAISON® assay missed the diagnosis of primary infection in 4 sera with low IgG. |
| abstract_unstemmed |
• LIAISON® IgG Avidity II and VIDAS® II CMV IgG Avidity assays were compared. • Correlation between the 2 assays was 77% in 280 sera with positive IgM. • The LIAISON® assay reached more rapidly higher avidity status than the VIDAS® assay. • The LIAISON® assay missed the diagnosis of primary infection in 4 sera with low IgG. |
| collection_details |
GBV_USEFLAG_U GBV_ELV SYSFLAG_U SSG-OLC-PHA |
| title_short |
Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women |
| url |
https://doi.org/10.1016/j.jcv.2015.08.018 |
| remote_bool |
true |
| author2 |
Guilleminot, Tiffany Ville, Yves Leruez-Ville, Marianne |
| author2Str |
Guilleminot, Tiffany Ville, Yves Leruez-Ville, Marianne |
| ppnlink |
ELV007727844 |
| mediatype_str_mv |
z |
| isOA_txt |
false |
| hochschulschrift_bool |
false |
| author2_role |
oth oth oth |
| doi_str |
10.1016/j.jcv.2015.08.018 |
| up_date |
2024-07-06T18:17:37.358Z |
| _version_ |
1803854657470070784 |
| fullrecord_marcxml |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">ELV018216323</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230623142520.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">180602s2015 xx |||||o 00| ||eng c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1016/j.jcv.2015.08.018</subfield><subfield code="2">doi</subfield></datafield><datafield tag="028" ind1="5" ind2="2"><subfield code="a">GBVA2015003000004.pica</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)ELV018216323</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ELSEVIER)S1386-6532(15)00653-8</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">610</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">610</subfield><subfield code="q">DE-600</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">616.019405</subfield><subfield code="q">OCLC</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">610</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">44.45</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Sellier, Yann</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Comparison of the LIAISON® CMV IgG Avidity II and the VIDAS® CMV IgG Avidity II assays for the diagnosis of primary infection in pregnant women</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2015</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">3</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zzz</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">z</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zu</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">• LIAISON® IgG Avidity II and VIDAS® II CMV IgG Avidity assays were compared. • Correlation between the 2 assays was 77% in 280 sera with positive IgM. • The LIAISON® assay reached more rapidly higher avidity status than the VIDAS® assay. • The LIAISON® assay missed the diagnosis of primary infection in 4 sera with low IgG.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Cytomegalovirus</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">IgG avidity</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Primary infection</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">LIAISON</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">VIDAS</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Guilleminot, Tiffany</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Ville, Yves</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Leruez-Ville, Marianne</subfield><subfield code="4">oth</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">Enthalten in</subfield><subfield code="n">Elsevier Science</subfield><subfield code="a">Scheen, Marc ELSEVIER</subfield><subfield code="t">Kidney disease in antiphospholipid antibody syndrome: Risk factors, pathophysiology and management</subfield><subfield code="d">2022</subfield><subfield code="g">Amsterdam [u.a.]</subfield><subfield code="w">(DE-627)ELV007727844</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:72</subfield><subfield code="g">year:2015</subfield><subfield code="g">pages:46-48</subfield><subfield code="g">extent:3</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.1016/j.jcv.2015.08.018</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ELV</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SSG-OLC-PHA</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">44.45</subfield><subfield code="j">Immunologie</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">72</subfield><subfield code="j">2015</subfield><subfield code="h">46-48</subfield><subfield code="g">3</subfield></datafield><datafield tag="953" ind1=" " ind2=" "><subfield code="2">045F</subfield><subfield code="a">610</subfield></datafield></record></collection>
|
| score |
7.4010057 |