Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin
Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyz...
Ausführliche Beschreibung
Autor*in: |
Williams, Kelly L. [verfasserIn] |
---|
Format: |
E-Artikel |
---|---|
Sprache: |
Englisch |
Erschienen: |
2015transfer abstract |
---|
Schlagwörter: |
---|
Umfang: |
5 |
---|
Übergeordnetes Werk: |
Enthalten in: Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors - Zidane, Mustapha ELSEVIER, 2021, Amsterdam [u.a.] |
---|---|
Übergeordnetes Werk: |
volume:36 ; year:2015 ; number:12 ; pages:33341-33345 ; extent:5 |
Links: |
---|
DOI / URN: |
10.1016/j.neurobiolaging.2015.08.013 |
---|
Katalog-ID: |
ELV018418589 |
---|
LEADER | 01000caa a22002652 4500 | ||
---|---|---|---|
001 | ELV018418589 | ||
003 | DE-627 | ||
005 | 20230625124000.0 | ||
007 | cr uuu---uuuuu | ||
008 | 180602s2015 xx |||||o 00| ||eng c | ||
024 | 7 | |a 10.1016/j.neurobiolaging.2015.08.013 |2 doi | |
028 | 5 | 2 | |a GBVA2015008000023.pica |
035 | |a (DE-627)ELV018418589 | ||
035 | |a (ELSEVIER)S0197-4580(15)00424-8 | ||
040 | |a DE-627 |b ger |c DE-627 |e rakwb | ||
041 | |a eng | ||
082 | 0 | |a 610 | |
082 | 0 | 4 | |a 610 |q DE-600 |
082 | 0 | 4 | |a 550 |a 520 |q VZ |
084 | |a 38.70 |2 bkl | ||
084 | |a 39.53 |2 bkl | ||
100 | 1 | |a Williams, Kelly L. |e verfasserin |4 aut | |
245 | 1 | 0 | |a Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin |
264 | 1 | |c 2015transfer abstract | |
300 | |a 5 | ||
336 | |a nicht spezifiziert |b zzz |2 rdacontent | ||
337 | |a nicht spezifiziert |b z |2 rdamedia | ||
338 | |a nicht spezifiziert |b zu |2 rdacarrier | ||
520 | |a Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. | ||
520 | |a Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. | ||
650 | 7 | |a TBK1 |2 Elsevier | |
650 | 7 | |a Frameshift |2 Elsevier | |
650 | 7 | |a Gene |2 Elsevier | |
650 | 7 | |a Motor neuron disease |2 Elsevier | |
650 | 7 | |a Amyotrophic lateral sclerosis |2 Elsevier | |
650 | 7 | |a Mutation |2 Elsevier | |
700 | 1 | |a McCann, Emily P. |4 oth | |
700 | 1 | |a Fifita, Jennifer A. |4 oth | |
700 | 1 | |a Zhang, Katharine |4 oth | |
700 | 1 | |a Duncan, Emma L. |4 oth | |
700 | 1 | |a Leo, Paul J. |4 oth | |
700 | 1 | |a Marshall, Mhairi |4 oth | |
700 | 1 | |a Rowe, Dominic B. |4 oth | |
700 | 1 | |a Nicholson, Garth A. |4 oth | |
700 | 1 | |a Blair, Ian P. |4 oth | |
773 | 0 | 8 | |i Enthalten in |n Elsevier Science |a Zidane, Mustapha ELSEVIER |t Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors |d 2021 |g Amsterdam [u.a.] |w (DE-627)ELV005660645 |
773 | 1 | 8 | |g volume:36 |g year:2015 |g number:12 |g pages:33341-33345 |g extent:5 |
856 | 4 | 0 | |u https://doi.org/10.1016/j.neurobiolaging.2015.08.013 |3 Volltext |
912 | |a GBV_USEFLAG_U | ||
912 | |a GBV_ELV | ||
912 | |a SYSFLAG_U | ||
912 | |a SSG-OPC-GGO | ||
912 | |a SSG-OPC-GEO | ||
912 | |a SSG-OPC-AST | ||
936 | b | k | |a 38.70 |j Geophysik: Allgemeines |q VZ |
936 | b | k | |a 39.53 |j Planeten |q VZ |
951 | |a AR | ||
952 | |d 36 |j 2015 |e 12 |h 33341-33345 |g 5 |y 36.2015, 12, 3334.e1-, (5 S.) | ||
953 | |2 045F |a 610 |
author_variant |
k l w kl klw |
---|---|
matchkey_str |
williamskellylmccannemilypfifitajennifer:2015----:oetktuctnmttoiaaiilmorpiltrlceo |
hierarchy_sort_str |
2015transfer abstract |
bklnumber |
38.70 39.53 |
publishDate |
2015 |
allfields |
10.1016/j.neurobiolaging.2015.08.013 doi GBVA2015008000023.pica (DE-627)ELV018418589 (ELSEVIER)S0197-4580(15)00424-8 DE-627 ger DE-627 rakwb eng 610 610 DE-600 550 520 VZ 38.70 bkl 39.53 bkl Williams, Kelly L. verfasserin aut Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin 2015transfer abstract 5 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. TBK1 Elsevier Frameshift Elsevier Gene Elsevier Motor neuron disease Elsevier Amyotrophic lateral sclerosis Elsevier Mutation Elsevier McCann, Emily P. oth Fifita, Jennifer A. oth Zhang, Katharine oth Duncan, Emma L. oth Leo, Paul J. oth Marshall, Mhairi oth Rowe, Dominic B. oth Nicholson, Garth A. oth Blair, Ian P. oth Enthalten in Elsevier Science Zidane, Mustapha ELSEVIER Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors 2021 Amsterdam [u.a.] (DE-627)ELV005660645 volume:36 year:2015 number:12 pages:33341-33345 extent:5 https://doi.org/10.1016/j.neurobiolaging.2015.08.013 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U SSG-OPC-GGO SSG-OPC-GEO SSG-OPC-AST 38.70 Geophysik: Allgemeines VZ 39.53 Planeten VZ AR 36 2015 12 33341-33345 5 36.2015, 12, 3334.e1-, (5 S.) 045F 610 |
spelling |
10.1016/j.neurobiolaging.2015.08.013 doi GBVA2015008000023.pica (DE-627)ELV018418589 (ELSEVIER)S0197-4580(15)00424-8 DE-627 ger DE-627 rakwb eng 610 610 DE-600 550 520 VZ 38.70 bkl 39.53 bkl Williams, Kelly L. verfasserin aut Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin 2015transfer abstract 5 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. TBK1 Elsevier Frameshift Elsevier Gene Elsevier Motor neuron disease Elsevier Amyotrophic lateral sclerosis Elsevier Mutation Elsevier McCann, Emily P. oth Fifita, Jennifer A. oth Zhang, Katharine oth Duncan, Emma L. oth Leo, Paul J. oth Marshall, Mhairi oth Rowe, Dominic B. oth Nicholson, Garth A. oth Blair, Ian P. oth Enthalten in Elsevier Science Zidane, Mustapha ELSEVIER Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors 2021 Amsterdam [u.a.] (DE-627)ELV005660645 volume:36 year:2015 number:12 pages:33341-33345 extent:5 https://doi.org/10.1016/j.neurobiolaging.2015.08.013 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U SSG-OPC-GGO SSG-OPC-GEO SSG-OPC-AST 38.70 Geophysik: Allgemeines VZ 39.53 Planeten VZ AR 36 2015 12 33341-33345 5 36.2015, 12, 3334.e1-, (5 S.) 045F 610 |
allfields_unstemmed |
10.1016/j.neurobiolaging.2015.08.013 doi GBVA2015008000023.pica (DE-627)ELV018418589 (ELSEVIER)S0197-4580(15)00424-8 DE-627 ger DE-627 rakwb eng 610 610 DE-600 550 520 VZ 38.70 bkl 39.53 bkl Williams, Kelly L. verfasserin aut Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin 2015transfer abstract 5 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. TBK1 Elsevier Frameshift Elsevier Gene Elsevier Motor neuron disease Elsevier Amyotrophic lateral sclerosis Elsevier Mutation Elsevier McCann, Emily P. oth Fifita, Jennifer A. oth Zhang, Katharine oth Duncan, Emma L. oth Leo, Paul J. oth Marshall, Mhairi oth Rowe, Dominic B. oth Nicholson, Garth A. oth Blair, Ian P. oth Enthalten in Elsevier Science Zidane, Mustapha ELSEVIER Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors 2021 Amsterdam [u.a.] (DE-627)ELV005660645 volume:36 year:2015 number:12 pages:33341-33345 extent:5 https://doi.org/10.1016/j.neurobiolaging.2015.08.013 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U SSG-OPC-GGO SSG-OPC-GEO SSG-OPC-AST 38.70 Geophysik: Allgemeines VZ 39.53 Planeten VZ AR 36 2015 12 33341-33345 5 36.2015, 12, 3334.e1-, (5 S.) 045F 610 |
allfieldsGer |
10.1016/j.neurobiolaging.2015.08.013 doi GBVA2015008000023.pica (DE-627)ELV018418589 (ELSEVIER)S0197-4580(15)00424-8 DE-627 ger DE-627 rakwb eng 610 610 DE-600 550 520 VZ 38.70 bkl 39.53 bkl Williams, Kelly L. verfasserin aut Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin 2015transfer abstract 5 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. TBK1 Elsevier Frameshift Elsevier Gene Elsevier Motor neuron disease Elsevier Amyotrophic lateral sclerosis Elsevier Mutation Elsevier McCann, Emily P. oth Fifita, Jennifer A. oth Zhang, Katharine oth Duncan, Emma L. oth Leo, Paul J. oth Marshall, Mhairi oth Rowe, Dominic B. oth Nicholson, Garth A. oth Blair, Ian P. oth Enthalten in Elsevier Science Zidane, Mustapha ELSEVIER Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors 2021 Amsterdam [u.a.] (DE-627)ELV005660645 volume:36 year:2015 number:12 pages:33341-33345 extent:5 https://doi.org/10.1016/j.neurobiolaging.2015.08.013 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U SSG-OPC-GGO SSG-OPC-GEO SSG-OPC-AST 38.70 Geophysik: Allgemeines VZ 39.53 Planeten VZ AR 36 2015 12 33341-33345 5 36.2015, 12, 3334.e1-, (5 S.) 045F 610 |
allfieldsSound |
10.1016/j.neurobiolaging.2015.08.013 doi GBVA2015008000023.pica (DE-627)ELV018418589 (ELSEVIER)S0197-4580(15)00424-8 DE-627 ger DE-627 rakwb eng 610 610 DE-600 550 520 VZ 38.70 bkl 39.53 bkl Williams, Kelly L. verfasserin aut Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin 2015transfer abstract 5 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. TBK1 Elsevier Frameshift Elsevier Gene Elsevier Motor neuron disease Elsevier Amyotrophic lateral sclerosis Elsevier Mutation Elsevier McCann, Emily P. oth Fifita, Jennifer A. oth Zhang, Katharine oth Duncan, Emma L. oth Leo, Paul J. oth Marshall, Mhairi oth Rowe, Dominic B. oth Nicholson, Garth A. oth Blair, Ian P. oth Enthalten in Elsevier Science Zidane, Mustapha ELSEVIER Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors 2021 Amsterdam [u.a.] (DE-627)ELV005660645 volume:36 year:2015 number:12 pages:33341-33345 extent:5 https://doi.org/10.1016/j.neurobiolaging.2015.08.013 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U SSG-OPC-GGO SSG-OPC-GEO SSG-OPC-AST 38.70 Geophysik: Allgemeines VZ 39.53 Planeten VZ AR 36 2015 12 33341-33345 5 36.2015, 12, 3334.e1-, (5 S.) 045F 610 |
language |
English |
source |
Enthalten in Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors Amsterdam [u.a.] volume:36 year:2015 number:12 pages:33341-33345 extent:5 |
sourceStr |
Enthalten in Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors Amsterdam [u.a.] volume:36 year:2015 number:12 pages:33341-33345 extent:5 |
format_phy_str_mv |
Article |
bklname |
Geophysik: Allgemeines Planeten |
institution |
findex.gbv.de |
topic_facet |
TBK1 Frameshift Gene Motor neuron disease Amyotrophic lateral sclerosis Mutation |
dewey-raw |
610 |
isfreeaccess_bool |
false |
container_title |
Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors |
authorswithroles_txt_mv |
Williams, Kelly L. @@aut@@ McCann, Emily P. @@oth@@ Fifita, Jennifer A. @@oth@@ Zhang, Katharine @@oth@@ Duncan, Emma L. @@oth@@ Leo, Paul J. @@oth@@ Marshall, Mhairi @@oth@@ Rowe, Dominic B. @@oth@@ Nicholson, Garth A. @@oth@@ Blair, Ian P. @@oth@@ |
publishDateDaySort_date |
2015-01-01T00:00:00Z |
hierarchy_top_id |
ELV005660645 |
dewey-sort |
3610 |
id |
ELV018418589 |
language_de |
englisch |
fullrecord |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">ELV018418589</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230625124000.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">180602s2015 xx |||||o 00| ||eng c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1016/j.neurobiolaging.2015.08.013</subfield><subfield code="2">doi</subfield></datafield><datafield tag="028" ind1="5" ind2="2"><subfield code="a">GBVA2015008000023.pica</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)ELV018418589</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ELSEVIER)S0197-4580(15)00424-8</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">610</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">610</subfield><subfield code="q">DE-600</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">550</subfield><subfield code="a">520</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">38.70</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">39.53</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Williams, Kelly L.</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2015transfer abstract</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">5</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zzz</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">z</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zu</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia.</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TBK1</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Frameshift</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Gene</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Motor neuron disease</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Amyotrophic lateral sclerosis</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Mutation</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">McCann, Emily P.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Fifita, Jennifer A.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Zhang, Katharine</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Duncan, Emma L.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Leo, Paul J.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Marshall, Mhairi</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Rowe, Dominic B.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Nicholson, Garth A.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Blair, Ian P.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">Enthalten in</subfield><subfield code="n">Elsevier Science</subfield><subfield code="a">Zidane, Mustapha ELSEVIER</subfield><subfield code="t">Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors</subfield><subfield code="d">2021</subfield><subfield code="g">Amsterdam [u.a.]</subfield><subfield code="w">(DE-627)ELV005660645</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:36</subfield><subfield code="g">year:2015</subfield><subfield code="g">number:12</subfield><subfield code="g">pages:33341-33345</subfield><subfield code="g">extent:5</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.1016/j.neurobiolaging.2015.08.013</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ELV</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SSG-OPC-GGO</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SSG-OPC-GEO</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SSG-OPC-AST</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">38.70</subfield><subfield code="j">Geophysik: Allgemeines</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">39.53</subfield><subfield code="j">Planeten</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">36</subfield><subfield code="j">2015</subfield><subfield code="e">12</subfield><subfield code="h">33341-33345</subfield><subfield code="g">5</subfield><subfield code="y">36.2015, 12, 3334.e1-, (5 S.)</subfield></datafield><datafield tag="953" ind1=" " ind2=" "><subfield code="2">045F</subfield><subfield code="a">610</subfield></datafield></record></collection>
|
author |
Williams, Kelly L. |
spellingShingle |
Williams, Kelly L. ddc 610 ddc 550 bkl 38.70 bkl 39.53 Elsevier TBK1 Elsevier Frameshift Elsevier Gene Elsevier Motor neuron disease Elsevier Amyotrophic lateral sclerosis Elsevier Mutation Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin |
authorStr |
Williams, Kelly L. |
ppnlink_with_tag_str_mv |
@@773@@(DE-627)ELV005660645 |
format |
electronic Article |
dewey-ones |
610 - Medicine & health 550 - Earth sciences 520 - Astronomy & allied sciences |
delete_txt_mv |
keep |
author_role |
aut |
collection |
elsevier |
remote_str |
true |
illustrated |
Not Illustrated |
topic_title |
610 610 DE-600 550 520 VZ 38.70 bkl 39.53 bkl Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin TBK1 Elsevier Frameshift Elsevier Gene Elsevier Motor neuron disease Elsevier Amyotrophic lateral sclerosis Elsevier Mutation Elsevier |
topic |
ddc 610 ddc 550 bkl 38.70 bkl 39.53 Elsevier TBK1 Elsevier Frameshift Elsevier Gene Elsevier Motor neuron disease Elsevier Amyotrophic lateral sclerosis Elsevier Mutation |
topic_unstemmed |
ddc 610 ddc 550 bkl 38.70 bkl 39.53 Elsevier TBK1 Elsevier Frameshift Elsevier Gene Elsevier Motor neuron disease Elsevier Amyotrophic lateral sclerosis Elsevier Mutation |
topic_browse |
ddc 610 ddc 550 bkl 38.70 bkl 39.53 Elsevier TBK1 Elsevier Frameshift Elsevier Gene Elsevier Motor neuron disease Elsevier Amyotrophic lateral sclerosis Elsevier Mutation |
format_facet |
Elektronische Aufsätze Aufsätze Elektronische Ressource |
format_main_str_mv |
Text Zeitschrift/Artikel |
carriertype_str_mv |
zu |
author2_variant |
e p m ep epm j a f ja jaf k z kz e l d el eld p j l pj pjl m m mm d b r db dbr g a n ga gan i p b ip ipb |
hierarchy_parent_title |
Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors |
hierarchy_parent_id |
ELV005660645 |
dewey-tens |
610 - Medicine & health 550 - Earth sciences & geology 520 - Astronomy |
hierarchy_top_title |
Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors |
isfreeaccess_txt |
false |
familylinks_str_mv |
(DE-627)ELV005660645 |
title |
Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin |
ctrlnum |
(DE-627)ELV018418589 (ELSEVIER)S0197-4580(15)00424-8 |
title_full |
Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin |
author_sort |
Williams, Kelly L. |
journal |
Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors |
journalStr |
Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors |
lang_code |
eng |
isOA_bool |
false |
dewey-hundreds |
600 - Technology 500 - Science |
recordtype |
marc |
publishDateSort |
2015 |
contenttype_str_mv |
zzz |
container_start_page |
33341 |
author_browse |
Williams, Kelly L. |
container_volume |
36 |
physical |
5 |
class |
610 610 DE-600 550 520 VZ 38.70 bkl 39.53 bkl |
format_se |
Elektronische Aufsätze |
author-letter |
Williams, Kelly L. |
doi_str_mv |
10.1016/j.neurobiolaging.2015.08.013 |
dewey-full |
610 550 520 |
title_sort |
novel tbk1 truncating mutation in a familial amyotrophic lateral sclerosis patient of chinese origin |
title_auth |
Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin |
abstract |
Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. |
abstractGer |
Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. |
abstract_unstemmed |
Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia. |
collection_details |
GBV_USEFLAG_U GBV_ELV SYSFLAG_U SSG-OPC-GGO SSG-OPC-GEO SSG-OPC-AST |
container_issue |
12 |
title_short |
Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin |
url |
https://doi.org/10.1016/j.neurobiolaging.2015.08.013 |
remote_bool |
true |
author2 |
McCann, Emily P. Fifita, Jennifer A. Zhang, Katharine Duncan, Emma L. Leo, Paul J. Marshall, Mhairi Rowe, Dominic B. Nicholson, Garth A. Blair, Ian P. |
author2Str |
McCann, Emily P. Fifita, Jennifer A. Zhang, Katharine Duncan, Emma L. Leo, Paul J. Marshall, Mhairi Rowe, Dominic B. Nicholson, Garth A. Blair, Ian P. |
ppnlink |
ELV005660645 |
mediatype_str_mv |
z |
isOA_txt |
false |
hochschulschrift_bool |
false |
author2_role |
oth oth oth oth oth oth oth oth oth |
doi_str |
10.1016/j.neurobiolaging.2015.08.013 |
up_date |
2024-07-06T18:46:05.051Z |
_version_ |
1803856448114917376 |
fullrecord_marcxml |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">ELV018418589</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230625124000.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">180602s2015 xx |||||o 00| ||eng c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1016/j.neurobiolaging.2015.08.013</subfield><subfield code="2">doi</subfield></datafield><datafield tag="028" ind1="5" ind2="2"><subfield code="a">GBVA2015008000023.pica</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)ELV018418589</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ELSEVIER)S0197-4580(15)00424-8</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">610</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">610</subfield><subfield code="q">DE-600</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">550</subfield><subfield code="a">520</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">38.70</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">39.53</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Williams, Kelly L.</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2015transfer abstract</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">5</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zzz</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">z</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zu</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia.</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Missense and frameshift mutations in TRAF family member-associated NF-kappa-B activator (TANK)-binding kinase 1 (TBK1) have been reported in European sporadic and familial amyotrophic lateral sclerosis (ALS) cohorts. To assess the role of TBK1 in ALS patient cohorts of wider ancestry, we have analyzed whole-exome sequence data from an Australian cohort of familial ALS (FALS) patients and controls. We identified a novel TBK1 deletion (c.1197delC) in a FALS patient of Chinese origin. This frameshift mutation (p.L399fs) likely results in a truncated protein that lacks functional domains required for adapter protein binding, as well as protein activation and structural integrity. No novel or reported TBK1 mutations were identified in FALS patients of European ancestry. This is the first report of a TBK1 mutation in an ALS patient of Asian origin and indicates that sequence variations in TBK1 are a rare cause of FALS in Australia.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TBK1</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Frameshift</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Gene</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Motor neuron disease</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Amyotrophic lateral sclerosis</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Mutation</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">McCann, Emily P.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Fifita, Jennifer A.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Zhang, Katharine</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Duncan, Emma L.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Leo, Paul J.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Marshall, Mhairi</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Rowe, Dominic B.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Nicholson, Garth A.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Blair, Ian P.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">Enthalten in</subfield><subfield code="n">Elsevier Science</subfield><subfield code="a">Zidane, Mustapha ELSEVIER</subfield><subfield code="t">Corrigendum to “Electrical and thermal transport properties of Fe–Ni based ternary alloys in the earth's inner core: An ab initio study” [Physics of the Earth and Planetary Interiors</subfield><subfield code="d">2021</subfield><subfield code="g">Amsterdam [u.a.]</subfield><subfield code="w">(DE-627)ELV005660645</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:36</subfield><subfield code="g">year:2015</subfield><subfield code="g">number:12</subfield><subfield code="g">pages:33341-33345</subfield><subfield code="g">extent:5</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.1016/j.neurobiolaging.2015.08.013</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ELV</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SSG-OPC-GGO</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SSG-OPC-GEO</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SSG-OPC-AST</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">38.70</subfield><subfield code="j">Geophysik: Allgemeines</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">39.53</subfield><subfield code="j">Planeten</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">36</subfield><subfield code="j">2015</subfield><subfield code="e">12</subfield><subfield code="h">33341-33345</subfield><subfield code="g">5</subfield><subfield code="y">36.2015, 12, 3334.e1-, (5 S.)</subfield></datafield><datafield tag="953" ind1=" " ind2=" "><subfield code="2">045F</subfield><subfield code="a">610</subfield></datafield></record></collection>
|
score |
7.4000463 |