Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis
Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates...
Ausführliche Beschreibung
Gespeichert in:
| Autor*in: |
Gremmel, Thomas [verfasserIn] |
|---|
| Format: |
E-Artikel |
|---|---|
| Sprache: |
Englisch |
| Erschienen: |
2014transfer abstract |
|---|
| Schlagwörter: |
|---|
| Umfang: |
4 |
|---|
| Übergeordnetes Werk: |
Enthalten in: No title available - 237(2014), 2, Seite 692-695 |
|---|---|
| Übergeordnetes Werk: |
volume:237 ; year:2014 ; number:2 ; pages:692-695 ; extent:4 |
| Links: |
|---|
| DOI / URN: |
10.1016/j.atherosclerosis.2014.10.095 |
|---|
| Katalog-ID: |
ELV028481925 |
|---|
| LEADER | 01000caa a22002652 4500 | ||
|---|---|---|---|
| 001 | ELV028481925 | ||
| 003 | DE-627 | ||
| 005 | 20230625160359.0 | ||
| 007 | cr uuu---uuuuu | ||
| 008 | 180603s2014 xx |||||o 00| ||eng c | ||
| 024 | 7 | |a 10.1016/j.atherosclerosis.2014.10.095 |2 doi | |
| 028 | 5 | 2 | |a /export/home/cbs_olc/import_discovery/elsevier/convert/GBV-Archive_01_06_pica_neu/GBVA2014021000017.pica |
| 035 | |a (DE-627)ELV028481925 | ||
| 035 | |a (ELSEVIER)S0021-9150(14)01550-0 | ||
| 040 | |a DE-627 |b ger |c DE-627 |e rakwb | ||
| 041 | |a eng | ||
| 100 | 1 | |a Gremmel, Thomas |e verfasserin |4 aut | |
| 245 | 1 | 0 | |a Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis |
| 264 | 1 | |c 2014transfer abstract | |
| 300 | |a 4 | ||
| 336 | |a nicht spezifiziert |b zzz |2 rdacontent | ||
| 337 | |a nicht spezifiziert |b z |2 rdamedia | ||
| 338 | |a nicht spezifiziert |b zu |2 rdacarrier | ||
| 520 | |a Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. | ||
| 520 | |a Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. | ||
| 650 | 7 | |a Leukocyte–platelet aggregates |2 Elsevier | |
| 650 | 7 | |a Platelet activation |2 Elsevier | |
| 650 | 7 | |a Platelet reactivity |2 Elsevier | |
| 650 | 7 | |a Sex |2 Elsevier | |
| 700 | 1 | |a Kopp, Christoph W. |4 oth | |
| 700 | 1 | |a Eichelberger, Beate |4 oth | |
| 700 | 1 | |a Koppensteiner, Renate |4 oth | |
| 700 | 1 | |a Panzer, Simon |4 oth | |
| 773 | 0 | 8 | |i Enthalten in |t No title available |g 237(2014), 2, Seite 692-695 |w (DE-627)ELV012595616 |w (DE-600)1-9150 |7 nnns |
| 773 | 1 | 8 | |g volume:237 |g year:2014 |g number:2 |g pages:692-695 |g extent:4 |
| 856 | 4 | 0 | |u https://doi.org/10.1016/j.atherosclerosis.2014.10.095 |3 Volltext |
| 912 | |a GBV_USEFLAG_U | ||
| 912 | |a GBV_ELV | ||
| 912 | |a SYSFLAG_U | ||
| 912 | |a GBV_ILN_20 | ||
| 912 | |a GBV_ILN_40 | ||
| 912 | |a GBV_ILN_105 | ||
| 951 | |a AR | ||
| 952 | |d 237 |j 2014 |e 2 |h 692-695 |g 4 | ||
| author_variant |
t g tg |
|---|---|
| matchkey_str |
gremmelthomaskoppchristophweichelbergerb:2014----:edfeecsfekctpaeeitrcinadnramnpaeeratvti |
| hierarchy_sort_str |
2014transfer abstract |
| publishDate |
2014 |
| allfields |
10.1016/j.atherosclerosis.2014.10.095 doi /export/home/cbs_olc/import_discovery/elsevier/convert/GBV-Archive_01_06_pica_neu/GBVA2014021000017.pica (DE-627)ELV028481925 (ELSEVIER)S0021-9150(14)01550-0 DE-627 ger DE-627 rakwb eng Gremmel, Thomas verfasserin aut Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis 2014transfer abstract 4 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. Leukocyte–platelet aggregates Elsevier Platelet activation Elsevier Platelet reactivity Elsevier Sex Elsevier Kopp, Christoph W. oth Eichelberger, Beate oth Koppensteiner, Renate oth Panzer, Simon oth Enthalten in No title available 237(2014), 2, Seite 692-695 (DE-627)ELV012595616 (DE-600)1-9150 nnns volume:237 year:2014 number:2 pages:692-695 extent:4 https://doi.org/10.1016/j.atherosclerosis.2014.10.095 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U GBV_ILN_20 GBV_ILN_40 GBV_ILN_105 AR 237 2014 2 692-695 4 |
| spelling |
10.1016/j.atherosclerosis.2014.10.095 doi /export/home/cbs_olc/import_discovery/elsevier/convert/GBV-Archive_01_06_pica_neu/GBVA2014021000017.pica (DE-627)ELV028481925 (ELSEVIER)S0021-9150(14)01550-0 DE-627 ger DE-627 rakwb eng Gremmel, Thomas verfasserin aut Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis 2014transfer abstract 4 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. Leukocyte–platelet aggregates Elsevier Platelet activation Elsevier Platelet reactivity Elsevier Sex Elsevier Kopp, Christoph W. oth Eichelberger, Beate oth Koppensteiner, Renate oth Panzer, Simon oth Enthalten in No title available 237(2014), 2, Seite 692-695 (DE-627)ELV012595616 (DE-600)1-9150 nnns volume:237 year:2014 number:2 pages:692-695 extent:4 https://doi.org/10.1016/j.atherosclerosis.2014.10.095 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U GBV_ILN_20 GBV_ILN_40 GBV_ILN_105 AR 237 2014 2 692-695 4 |
| allfields_unstemmed |
10.1016/j.atherosclerosis.2014.10.095 doi /export/home/cbs_olc/import_discovery/elsevier/convert/GBV-Archive_01_06_pica_neu/GBVA2014021000017.pica (DE-627)ELV028481925 (ELSEVIER)S0021-9150(14)01550-0 DE-627 ger DE-627 rakwb eng Gremmel, Thomas verfasserin aut Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis 2014transfer abstract 4 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. Leukocyte–platelet aggregates Elsevier Platelet activation Elsevier Platelet reactivity Elsevier Sex Elsevier Kopp, Christoph W. oth Eichelberger, Beate oth Koppensteiner, Renate oth Panzer, Simon oth Enthalten in No title available 237(2014), 2, Seite 692-695 (DE-627)ELV012595616 (DE-600)1-9150 nnns volume:237 year:2014 number:2 pages:692-695 extent:4 https://doi.org/10.1016/j.atherosclerosis.2014.10.095 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U GBV_ILN_20 GBV_ILN_40 GBV_ILN_105 AR 237 2014 2 692-695 4 |
| allfieldsGer |
10.1016/j.atherosclerosis.2014.10.095 doi /export/home/cbs_olc/import_discovery/elsevier/convert/GBV-Archive_01_06_pica_neu/GBVA2014021000017.pica (DE-627)ELV028481925 (ELSEVIER)S0021-9150(14)01550-0 DE-627 ger DE-627 rakwb eng Gremmel, Thomas verfasserin aut Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis 2014transfer abstract 4 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. Leukocyte–platelet aggregates Elsevier Platelet activation Elsevier Platelet reactivity Elsevier Sex Elsevier Kopp, Christoph W. oth Eichelberger, Beate oth Koppensteiner, Renate oth Panzer, Simon oth Enthalten in No title available 237(2014), 2, Seite 692-695 (DE-627)ELV012595616 (DE-600)1-9150 nnns volume:237 year:2014 number:2 pages:692-695 extent:4 https://doi.org/10.1016/j.atherosclerosis.2014.10.095 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U GBV_ILN_20 GBV_ILN_40 GBV_ILN_105 AR 237 2014 2 692-695 4 |
| allfieldsSound |
10.1016/j.atherosclerosis.2014.10.095 doi /export/home/cbs_olc/import_discovery/elsevier/convert/GBV-Archive_01_06_pica_neu/GBVA2014021000017.pica (DE-627)ELV028481925 (ELSEVIER)S0021-9150(14)01550-0 DE-627 ger DE-627 rakwb eng Gremmel, Thomas verfasserin aut Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis 2014transfer abstract 4 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. Leukocyte–platelet aggregates Elsevier Platelet activation Elsevier Platelet reactivity Elsevier Sex Elsevier Kopp, Christoph W. oth Eichelberger, Beate oth Koppensteiner, Renate oth Panzer, Simon oth Enthalten in No title available 237(2014), 2, Seite 692-695 (DE-627)ELV012595616 (DE-600)1-9150 nnns volume:237 year:2014 number:2 pages:692-695 extent:4 https://doi.org/10.1016/j.atherosclerosis.2014.10.095 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U GBV_ILN_20 GBV_ILN_40 GBV_ILN_105 AR 237 2014 2 692-695 4 |
| language |
English |
| source |
Enthalten in No title available 237(2014), 2, Seite 692-695 volume:237 year:2014 number:2 pages:692-695 extent:4 |
| sourceStr |
Enthalten in No title available 237(2014), 2, Seite 692-695 volume:237 year:2014 number:2 pages:692-695 extent:4 |
| format_phy_str_mv |
Article |
| institution |
findex.gbv.de |
| topic_facet |
Leukocyte–platelet aggregates Platelet activation Platelet reactivity Sex |
| isfreeaccess_bool |
false |
| container_title |
No title available |
| authorswithroles_txt_mv |
Gremmel, Thomas @@aut@@ Kopp, Christoph W. @@oth@@ Eichelberger, Beate @@oth@@ Koppensteiner, Renate @@oth@@ Panzer, Simon @@oth@@ |
| publishDateDaySort_date |
2014-01-01T00:00:00Z |
| hierarchy_top_id |
ELV012595616 |
| id |
ELV028481925 |
| language_de |
englisch |
| fullrecord |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">ELV028481925</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230625160359.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">180603s2014 xx |||||o 00| ||eng c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1016/j.atherosclerosis.2014.10.095</subfield><subfield code="2">doi</subfield></datafield><datafield tag="028" ind1="5" ind2="2"><subfield code="a">/export/home/cbs_olc/import_discovery/elsevier/convert/GBV-Archive_01_06_pica_neu/GBVA2014021000017.pica</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)ELV028481925</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ELSEVIER)S0021-9150(14)01550-0</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Gremmel, Thomas</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2014transfer abstract</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">4</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zzz</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">z</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zu</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease.</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Leukocyte–platelet aggregates</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Platelet activation</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Platelet reactivity</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Sex</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Kopp, Christoph W.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Eichelberger, Beate</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Koppensteiner, Renate</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Panzer, Simon</subfield><subfield code="4">oth</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">Enthalten in</subfield><subfield code="t">No title available</subfield><subfield code="g">237(2014), 2, Seite 692-695</subfield><subfield code="w">(DE-627)ELV012595616</subfield><subfield code="w">(DE-600)1-9150</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:237</subfield><subfield code="g">year:2014</subfield><subfield code="g">number:2</subfield><subfield code="g">pages:692-695</subfield><subfield code="g">extent:4</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.1016/j.atherosclerosis.2014.10.095</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ELV</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_20</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_40</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_105</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">237</subfield><subfield code="j">2014</subfield><subfield code="e">2</subfield><subfield code="h">692-695</subfield><subfield code="g">4</subfield></datafield></record></collection>
|
| author |
Gremmel, Thomas |
| spellingShingle |
Gremmel, Thomas Elsevier Leukocyte–platelet aggregates Elsevier Platelet activation Elsevier Platelet reactivity Elsevier Sex Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis |
| authorStr |
Gremmel, Thomas |
| ppnlink_with_tag_str_mv |
@@773@@(DE-627)ELV012595616 |
| format |
electronic Article |
| delete_txt_mv |
keep |
| author_role |
aut |
| collection |
elsevier |
| remote_str |
true |
| illustrated |
Not Illustrated |
| topic_title |
Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis Leukocyte–platelet aggregates Elsevier Platelet activation Elsevier Platelet reactivity Elsevier Sex Elsevier |
| topic |
Elsevier Leukocyte–platelet aggregates Elsevier Platelet activation Elsevier Platelet reactivity Elsevier Sex |
| topic_unstemmed |
Elsevier Leukocyte–platelet aggregates Elsevier Platelet activation Elsevier Platelet reactivity Elsevier Sex |
| topic_browse |
Elsevier Leukocyte–platelet aggregates Elsevier Platelet activation Elsevier Platelet reactivity Elsevier Sex |
| format_facet |
Elektronische Aufsätze Aufsätze Elektronische Ressource |
| format_main_str_mv |
Text Zeitschrift/Artikel |
| carriertype_str_mv |
zu |
| author2_variant |
c w k cw cwk b e be r k rk s p sp |
| hierarchy_parent_title |
No title available |
| hierarchy_parent_id |
ELV012595616 |
| hierarchy_top_title |
No title available |
| isfreeaccess_txt |
false |
| familylinks_str_mv |
(DE-627)ELV012595616 (DE-600)1-9150 |
| title |
Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis |
| ctrlnum |
(DE-627)ELV028481925 (ELSEVIER)S0021-9150(14)01550-0 |
| title_full |
Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis |
| author_sort |
Gremmel, Thomas |
| journal |
No title available |
| journalStr |
No title available |
| lang_code |
eng |
| isOA_bool |
false |
| recordtype |
marc |
| publishDateSort |
2014 |
| contenttype_str_mv |
zzz |
| container_start_page |
692 |
| author_browse |
Gremmel, Thomas |
| container_volume |
237 |
| physical |
4 |
| format_se |
Elektronische Aufsätze |
| author-letter |
Gremmel, Thomas |
| doi_str_mv |
10.1016/j.atherosclerosis.2014.10.095 |
| title_sort |
sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis |
| title_auth |
Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis |
| abstract |
Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. |
| abstractGer |
Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. |
| abstract_unstemmed |
Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease. |
| collection_details |
GBV_USEFLAG_U GBV_ELV SYSFLAG_U GBV_ILN_20 GBV_ILN_40 GBV_ILN_105 |
| container_issue |
2 |
| title_short |
Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis |
| url |
https://doi.org/10.1016/j.atherosclerosis.2014.10.095 |
| remote_bool |
true |
| author2 |
Kopp, Christoph W. Eichelberger, Beate Koppensteiner, Renate Panzer, Simon |
| author2Str |
Kopp, Christoph W. Eichelberger, Beate Koppensteiner, Renate Panzer, Simon |
| ppnlink |
ELV012595616 |
| mediatype_str_mv |
z |
| isOA_txt |
false |
| hochschulschrift_bool |
false |
| author2_role |
oth oth oth oth |
| doi_str |
10.1016/j.atherosclerosis.2014.10.095 |
| up_date |
2024-07-06T18:56:11.213Z |
| _version_ |
1803857083722891264 |
| fullrecord_marcxml |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">ELV028481925</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230625160359.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">180603s2014 xx |||||o 00| ||eng c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1016/j.atherosclerosis.2014.10.095</subfield><subfield code="2">doi</subfield></datafield><datafield tag="028" ind1="5" ind2="2"><subfield code="a">/export/home/cbs_olc/import_discovery/elsevier/convert/GBV-Archive_01_06_pica_neu/GBVA2014021000017.pica</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)ELV028481925</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ELSEVIER)S0021-9150(14)01550-0</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Gremmel, Thomas</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Sex differences of leukocyte–platelet interactions and on-treatment platelet reactivity in patients with atherosclerosis</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2014transfer abstract</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">4</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zzz</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">z</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zu</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease.</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Objective: To investigate differences of platelet activation and on-treatment residual platelet reactivity between female and male patients with atherosclerotic cardiovascular disease. Methods: We compared P-selectin expression, activated glycoprotein (GP) IIb/IIIa and leukocyte–platelet aggregates (LPA) by flow cytometry between 110 female and 206 male patients undergoing angioplasty and stenting. On-treatment residual platelet reactivity was determined by two test systems. Results: The expression of P-selectin and GPIIb/IIIa did not differ significantly between female and male patients. In contrast, females showed a significantly more pronounced formation of LPA in vivo, in response to thrombin receptor-activating peptide-6 and in response to adenosine diphosphate. Further, high LPA were seen more frequently in female patients. Finally, protease-activated receptor (PAR)-1 mediated platelet reactivity by both assays was significantly higher in females. Conclusion: Female sex is associated with a more pronounced formation of LPA and increased PAR-1 mediated platelet reactivity in atherosclerotic cardiovascular disease.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Leukocyte–platelet aggregates</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Platelet activation</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Platelet reactivity</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Sex</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Kopp, Christoph W.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Eichelberger, Beate</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Koppensteiner, Renate</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Panzer, Simon</subfield><subfield code="4">oth</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">Enthalten in</subfield><subfield code="t">No title available</subfield><subfield code="g">237(2014), 2, Seite 692-695</subfield><subfield code="w">(DE-627)ELV012595616</subfield><subfield code="w">(DE-600)1-9150</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:237</subfield><subfield code="g">year:2014</subfield><subfield code="g">number:2</subfield><subfield code="g">pages:692-695</subfield><subfield code="g">extent:4</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.1016/j.atherosclerosis.2014.10.095</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ELV</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_20</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_40</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_105</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">237</subfield><subfield code="j">2014</subfield><subfield code="e">2</subfield><subfield code="h">692-695</subfield><subfield code="g">4</subfield></datafield></record></collection>
|
| score |
7.4013147 |