Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem
• The residue theorem is employed in the design optimization of a vibrating structure. • The adjoint variable method is used for the design sensitivity computation. • Numerical examples demonstrate the computational efficiency of the optimization scheme. • High enhancement of the optimization proces...
Ausführliche Beschreibung
Gespeichert in:
| Autor*in: |
Koo, Kunmo [verfasserIn] |
|---|
| Format: |
E-Artikel |
|---|---|
| Sprache: |
Englisch |
| Erschienen: |
2014 |
|---|
| Schlagwörter: |
|---|
| Umfang: |
14 |
|---|
| Übergeordnetes Werk: |
Enthalten in: Conference Committee and Organizers - 2016, an international journal, Amsterdam [u.a.] |
|---|---|
| Übergeordnetes Werk: |
volume:145 ; year:2014 ; pages:58-71 ; extent:14 |
| Links: |
|---|
| DOI / URN: |
10.1016/j.compstruc.2014.08.005 |
|---|
| Katalog-ID: |
ELV033589852 |
|---|
| LEADER | 01000caa a22002652 4500 | ||
|---|---|---|---|
| 001 | ELV033589852 | ||
| 003 | DE-627 | ||
| 005 | 20230623230534.0 | ||
| 007 | cr uuu---uuuuu | ||
| 008 | 180603s2014 xx |||||o 00| ||eng c | ||
| 024 | 7 | |a 10.1016/j.compstruc.2014.08.005 |2 doi | |
| 028 | 5 | 2 | |a GBVA2014001000003.pica |
| 035 | |a (DE-627)ELV033589852 | ||
| 035 | |a (ELSEVIER)S0045-7949(14)00187-4 | ||
| 040 | |a DE-627 |b ger |c DE-627 |e rakwb | ||
| 041 | |a eng | ||
| 082 | 0 | |a 004 | |
| 082 | 0 | 4 | |a 004 |q DE-600 |
| 082 | 0 | 4 | |a 530 |q VZ |
| 082 | 0 | 4 | |a 670 |q VZ |
| 084 | |a 51.60 |2 bkl | ||
| 084 | |a 58.45 |2 bkl | ||
| 100 | 1 | |a Koo, Kunmo |e verfasserin |4 aut | |
| 245 | 1 | 0 | |a Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem |
| 264 | 1 | |c 2014 | |
| 300 | |a 14 | ||
| 336 | |a nicht spezifiziert |b zzz |2 rdacontent | ||
| 337 | |a nicht spezifiziert |b z |2 rdamedia | ||
| 338 | |a nicht spezifiziert |b zu |2 rdacarrier | ||
| 520 | |a • The residue theorem is employed in the design optimization of a vibrating structure. • The adjoint variable method is used for the design sensitivity computation. • Numerical examples demonstrate the computational efficiency of the optimization scheme. • High enhancement of the optimization process for the reduction of the radiated sound power. | ||
| 650 | 7 | |a Design sensitivity analysis |2 Elsevier | |
| 650 | 7 | |a Input power |2 Elsevier | |
| 650 | 7 | |a Vibro-acoustics |2 Elsevier | |
| 650 | 7 | |a Frequency averaging |2 Elsevier | |
| 650 | 7 | |a Residue theorem |2 Elsevier | |
| 700 | 1 | |a D’Amico, Roberto |4 oth | |
| 700 | 1 | |a Pluymers, Bert |4 oth | |
| 700 | 1 | |a Desmet, Wim |4 oth | |
| 773 | 0 | 8 | |i Enthalten in |n Elsevier |t Conference Committee and Organizers |d 2016 |d an international journal |g Amsterdam [u.a.] |w (DE-627)ELV019856989 |
| 773 | 1 | 8 | |g volume:145 |g year:2014 |g pages:58-71 |g extent:14 |
| 856 | 4 | 0 | |u https://doi.org/10.1016/j.compstruc.2014.08.005 |3 Volltext |
| 912 | |a GBV_USEFLAG_U | ||
| 912 | |a GBV_ELV | ||
| 912 | |a SYSFLAG_U | ||
| 936 | b | k | |a 51.60 |j Keramische Werkstoffe |j Hartstoffe |x Werkstoffkunde |q VZ |
| 936 | b | k | |a 58.45 |j Gesteinshüttenkunde |q VZ |
| 951 | |a AR | ||
| 952 | |d 145 |j 2014 |h 58-71 |g 14 | ||
| 953 | |2 045F |a 004 | ||
| author_variant |
k k kk |
|---|---|
| matchkey_str |
kookunmodamicorobertopluymersbertdesmetw:2014----:einestvtaayiadpiiainfrqecaeaeipto |
| hierarchy_sort_str |
2014 |
| bklnumber |
51.60 58.45 |
| publishDate |
2014 |
| allfields |
10.1016/j.compstruc.2014.08.005 doi GBVA2014001000003.pica (DE-627)ELV033589852 (ELSEVIER)S0045-7949(14)00187-4 DE-627 ger DE-627 rakwb eng 004 004 DE-600 530 VZ 670 VZ 51.60 bkl 58.45 bkl Koo, Kunmo verfasserin aut Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem 2014 14 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • The residue theorem is employed in the design optimization of a vibrating structure. • The adjoint variable method is used for the design sensitivity computation. • Numerical examples demonstrate the computational efficiency of the optimization scheme. • High enhancement of the optimization process for the reduction of the radiated sound power. Design sensitivity analysis Elsevier Input power Elsevier Vibro-acoustics Elsevier Frequency averaging Elsevier Residue theorem Elsevier D’Amico, Roberto oth Pluymers, Bert oth Desmet, Wim oth Enthalten in Elsevier Conference Committee and Organizers 2016 an international journal Amsterdam [u.a.] (DE-627)ELV019856989 volume:145 year:2014 pages:58-71 extent:14 https://doi.org/10.1016/j.compstruc.2014.08.005 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U 51.60 Keramische Werkstoffe Hartstoffe Werkstoffkunde VZ 58.45 Gesteinshüttenkunde VZ AR 145 2014 58-71 14 045F 004 |
| spelling |
10.1016/j.compstruc.2014.08.005 doi GBVA2014001000003.pica (DE-627)ELV033589852 (ELSEVIER)S0045-7949(14)00187-4 DE-627 ger DE-627 rakwb eng 004 004 DE-600 530 VZ 670 VZ 51.60 bkl 58.45 bkl Koo, Kunmo verfasserin aut Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem 2014 14 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • The residue theorem is employed in the design optimization of a vibrating structure. • The adjoint variable method is used for the design sensitivity computation. • Numerical examples demonstrate the computational efficiency of the optimization scheme. • High enhancement of the optimization process for the reduction of the radiated sound power. Design sensitivity analysis Elsevier Input power Elsevier Vibro-acoustics Elsevier Frequency averaging Elsevier Residue theorem Elsevier D’Amico, Roberto oth Pluymers, Bert oth Desmet, Wim oth Enthalten in Elsevier Conference Committee and Organizers 2016 an international journal Amsterdam [u.a.] (DE-627)ELV019856989 volume:145 year:2014 pages:58-71 extent:14 https://doi.org/10.1016/j.compstruc.2014.08.005 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U 51.60 Keramische Werkstoffe Hartstoffe Werkstoffkunde VZ 58.45 Gesteinshüttenkunde VZ AR 145 2014 58-71 14 045F 004 |
| allfields_unstemmed |
10.1016/j.compstruc.2014.08.005 doi GBVA2014001000003.pica (DE-627)ELV033589852 (ELSEVIER)S0045-7949(14)00187-4 DE-627 ger DE-627 rakwb eng 004 004 DE-600 530 VZ 670 VZ 51.60 bkl 58.45 bkl Koo, Kunmo verfasserin aut Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem 2014 14 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • The residue theorem is employed in the design optimization of a vibrating structure. • The adjoint variable method is used for the design sensitivity computation. • Numerical examples demonstrate the computational efficiency of the optimization scheme. • High enhancement of the optimization process for the reduction of the radiated sound power. Design sensitivity analysis Elsevier Input power Elsevier Vibro-acoustics Elsevier Frequency averaging Elsevier Residue theorem Elsevier D’Amico, Roberto oth Pluymers, Bert oth Desmet, Wim oth Enthalten in Elsevier Conference Committee and Organizers 2016 an international journal Amsterdam [u.a.] (DE-627)ELV019856989 volume:145 year:2014 pages:58-71 extent:14 https://doi.org/10.1016/j.compstruc.2014.08.005 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U 51.60 Keramische Werkstoffe Hartstoffe Werkstoffkunde VZ 58.45 Gesteinshüttenkunde VZ AR 145 2014 58-71 14 045F 004 |
| allfieldsGer |
10.1016/j.compstruc.2014.08.005 doi GBVA2014001000003.pica (DE-627)ELV033589852 (ELSEVIER)S0045-7949(14)00187-4 DE-627 ger DE-627 rakwb eng 004 004 DE-600 530 VZ 670 VZ 51.60 bkl 58.45 bkl Koo, Kunmo verfasserin aut Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem 2014 14 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • The residue theorem is employed in the design optimization of a vibrating structure. • The adjoint variable method is used for the design sensitivity computation. • Numerical examples demonstrate the computational efficiency of the optimization scheme. • High enhancement of the optimization process for the reduction of the radiated sound power. Design sensitivity analysis Elsevier Input power Elsevier Vibro-acoustics Elsevier Frequency averaging Elsevier Residue theorem Elsevier D’Amico, Roberto oth Pluymers, Bert oth Desmet, Wim oth Enthalten in Elsevier Conference Committee and Organizers 2016 an international journal Amsterdam [u.a.] (DE-627)ELV019856989 volume:145 year:2014 pages:58-71 extent:14 https://doi.org/10.1016/j.compstruc.2014.08.005 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U 51.60 Keramische Werkstoffe Hartstoffe Werkstoffkunde VZ 58.45 Gesteinshüttenkunde VZ AR 145 2014 58-71 14 045F 004 |
| allfieldsSound |
10.1016/j.compstruc.2014.08.005 doi GBVA2014001000003.pica (DE-627)ELV033589852 (ELSEVIER)S0045-7949(14)00187-4 DE-627 ger DE-627 rakwb eng 004 004 DE-600 530 VZ 670 VZ 51.60 bkl 58.45 bkl Koo, Kunmo verfasserin aut Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem 2014 14 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • The residue theorem is employed in the design optimization of a vibrating structure. • The adjoint variable method is used for the design sensitivity computation. • Numerical examples demonstrate the computational efficiency of the optimization scheme. • High enhancement of the optimization process for the reduction of the radiated sound power. Design sensitivity analysis Elsevier Input power Elsevier Vibro-acoustics Elsevier Frequency averaging Elsevier Residue theorem Elsevier D’Amico, Roberto oth Pluymers, Bert oth Desmet, Wim oth Enthalten in Elsevier Conference Committee and Organizers 2016 an international journal Amsterdam [u.a.] (DE-627)ELV019856989 volume:145 year:2014 pages:58-71 extent:14 https://doi.org/10.1016/j.compstruc.2014.08.005 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U 51.60 Keramische Werkstoffe Hartstoffe Werkstoffkunde VZ 58.45 Gesteinshüttenkunde VZ AR 145 2014 58-71 14 045F 004 |
| language |
English |
| source |
Enthalten in Conference Committee and Organizers Amsterdam [u.a.] volume:145 year:2014 pages:58-71 extent:14 |
| sourceStr |
Enthalten in Conference Committee and Organizers Amsterdam [u.a.] volume:145 year:2014 pages:58-71 extent:14 |
| format_phy_str_mv |
Article |
| bklname |
Keramische Werkstoffe Hartstoffe Gesteinshüttenkunde |
| institution |
findex.gbv.de |
| topic_facet |
Design sensitivity analysis Input power Vibro-acoustics Frequency averaging Residue theorem |
| dewey-raw |
004 |
| isfreeaccess_bool |
false |
| container_title |
Conference Committee and Organizers |
| authorswithroles_txt_mv |
Koo, Kunmo @@aut@@ D’Amico, Roberto @@oth@@ Pluymers, Bert @@oth@@ Desmet, Wim @@oth@@ |
| publishDateDaySort_date |
2014-01-01T00:00:00Z |
| hierarchy_top_id |
ELV019856989 |
| dewey-sort |
14 |
| id |
ELV033589852 |
| language_de |
englisch |
| fullrecord |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">ELV033589852</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230623230534.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">180603s2014 xx |||||o 00| ||eng c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1016/j.compstruc.2014.08.005</subfield><subfield code="2">doi</subfield></datafield><datafield tag="028" ind1="5" ind2="2"><subfield code="a">GBVA2014001000003.pica</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)ELV033589852</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ELSEVIER)S0045-7949(14)00187-4</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">004</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">004</subfield><subfield code="q">DE-600</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">530</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">670</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">51.60</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">58.45</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Koo, Kunmo</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">14</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zzz</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">z</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zu</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">• The residue theorem is employed in the design optimization of a vibrating structure. • The adjoint variable method is used for the design sensitivity computation. • Numerical examples demonstrate the computational efficiency of the optimization scheme. • High enhancement of the optimization process for the reduction of the radiated sound power.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Design sensitivity analysis</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Input power</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Vibro-acoustics</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Frequency averaging</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Residue theorem</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">D’Amico, Roberto</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Pluymers, Bert</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Desmet, Wim</subfield><subfield code="4">oth</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">Enthalten in</subfield><subfield code="n">Elsevier</subfield><subfield code="t">Conference Committee and Organizers</subfield><subfield code="d">2016</subfield><subfield code="d">an international journal</subfield><subfield code="g">Amsterdam [u.a.]</subfield><subfield code="w">(DE-627)ELV019856989</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:145</subfield><subfield code="g">year:2014</subfield><subfield code="g">pages:58-71</subfield><subfield code="g">extent:14</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.1016/j.compstruc.2014.08.005</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ELV</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_U</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">51.60</subfield><subfield code="j">Keramische Werkstoffe</subfield><subfield code="j">Hartstoffe</subfield><subfield code="x">Werkstoffkunde</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">58.45</subfield><subfield code="j">Gesteinshüttenkunde</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">145</subfield><subfield code="j">2014</subfield><subfield code="h">58-71</subfield><subfield code="g">14</subfield></datafield><datafield tag="953" ind1=" " ind2=" "><subfield code="2">045F</subfield><subfield code="a">004</subfield></datafield></record></collection>
|
| author |
Koo, Kunmo |
| spellingShingle |
Koo, Kunmo ddc 004 ddc 530 ddc 670 bkl 51.60 bkl 58.45 Elsevier Design sensitivity analysis Elsevier Input power Elsevier Vibro-acoustics Elsevier Frequency averaging Elsevier Residue theorem Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem |
| authorStr |
Koo, Kunmo |
| ppnlink_with_tag_str_mv |
@@773@@(DE-627)ELV019856989 |
| format |
electronic Article |
| dewey-ones |
004 - Data processing & computer science 530 - Physics 670 - Manufacturing |
| delete_txt_mv |
keep |
| author_role |
aut |
| collection |
elsevier |
| remote_str |
true |
| illustrated |
Not Illustrated |
| topic_title |
004 004 DE-600 530 VZ 670 VZ 51.60 bkl 58.45 bkl Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem Design sensitivity analysis Elsevier Input power Elsevier Vibro-acoustics Elsevier Frequency averaging Elsevier Residue theorem Elsevier |
| topic |
ddc 004 ddc 530 ddc 670 bkl 51.60 bkl 58.45 Elsevier Design sensitivity analysis Elsevier Input power Elsevier Vibro-acoustics Elsevier Frequency averaging Elsevier Residue theorem |
| topic_unstemmed |
ddc 004 ddc 530 ddc 670 bkl 51.60 bkl 58.45 Elsevier Design sensitivity analysis Elsevier Input power Elsevier Vibro-acoustics Elsevier Frequency averaging Elsevier Residue theorem |
| topic_browse |
ddc 004 ddc 530 ddc 670 bkl 51.60 bkl 58.45 Elsevier Design sensitivity analysis Elsevier Input power Elsevier Vibro-acoustics Elsevier Frequency averaging Elsevier Residue theorem |
| format_facet |
Elektronische Aufsätze Aufsätze Elektronische Ressource |
| format_main_str_mv |
Text Zeitschrift/Artikel |
| carriertype_str_mv |
zu |
| author2_variant |
r d rd b p bp w d wd |
| hierarchy_parent_title |
Conference Committee and Organizers |
| hierarchy_parent_id |
ELV019856989 |
| dewey-tens |
000 - Computer science, knowledge & systems 530 - Physics 670 - Manufacturing |
| hierarchy_top_title |
Conference Committee and Organizers |
| isfreeaccess_txt |
false |
| familylinks_str_mv |
(DE-627)ELV019856989 |
| title |
Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem |
| ctrlnum |
(DE-627)ELV033589852 (ELSEVIER)S0045-7949(14)00187-4 |
| title_full |
Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem |
| author_sort |
Koo, Kunmo |
| journal |
Conference Committee and Organizers |
| journalStr |
Conference Committee and Organizers |
| lang_code |
eng |
| isOA_bool |
false |
| dewey-hundreds |
000 - Computer science, information & general works 500 - Science 600 - Technology |
| recordtype |
marc |
| publishDateSort |
2014 |
| contenttype_str_mv |
zzz |
| container_start_page |
58 |
| author_browse |
Koo, Kunmo |
| container_volume |
145 |
| physical |
14 |
| class |
004 004 DE-600 530 VZ 670 VZ 51.60 bkl 58.45 bkl |
| format_se |
Elektronische Aufsätze |
| author-letter |
Koo, Kunmo |
| doi_str_mv |
10.1016/j.compstruc.2014.08.005 |
| dewey-full |
004 530 670 |
| title_sort |
design sensitivity analysis and optimization of frequency averaged input power using the residue theorem |
| title_auth |
Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem |
| abstract |
• The residue theorem is employed in the design optimization of a vibrating structure. • The adjoint variable method is used for the design sensitivity computation. • Numerical examples demonstrate the computational efficiency of the optimization scheme. • High enhancement of the optimization process for the reduction of the radiated sound power. |
| abstractGer |
• The residue theorem is employed in the design optimization of a vibrating structure. • The adjoint variable method is used for the design sensitivity computation. • Numerical examples demonstrate the computational efficiency of the optimization scheme. • High enhancement of the optimization process for the reduction of the radiated sound power. |
| abstract_unstemmed |
• The residue theorem is employed in the design optimization of a vibrating structure. • The adjoint variable method is used for the design sensitivity computation. • Numerical examples demonstrate the computational efficiency of the optimization scheme. • High enhancement of the optimization process for the reduction of the radiated sound power. |
| collection_details |
GBV_USEFLAG_U GBV_ELV SYSFLAG_U |
| title_short |
Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem |
| url |
https://doi.org/10.1016/j.compstruc.2014.08.005 |
| remote_bool |
true |
| author2 |
D’Amico, Roberto Pluymers, Bert Desmet, Wim |
| author2Str |
D’Amico, Roberto Pluymers, Bert Desmet, Wim |
| ppnlink |
ELV019856989 |
| mediatype_str_mv |
z |
| isOA_txt |
false |
| hochschulschrift_bool |
false |
| author2_role |
oth oth oth |
| doi_str |
10.1016/j.compstruc.2014.08.005 |
| up_date |
2024-07-06T18:56:17.925Z |
| _version_ |
1803857090760933376 |
| fullrecord_marcxml |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">ELV033589852</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230623230534.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">180603s2014 xx |||||o 00| ||eng c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1016/j.compstruc.2014.08.005</subfield><subfield code="2">doi</subfield></datafield><datafield tag="028" ind1="5" ind2="2"><subfield code="a">GBVA2014001000003.pica</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)ELV033589852</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ELSEVIER)S0045-7949(14)00187-4</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">004</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">004</subfield><subfield code="q">DE-600</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">530</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">670</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">51.60</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">58.45</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Koo, Kunmo</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Design sensitivity analysis and optimization of frequency averaged input power using the residue theorem</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">14</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zzz</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">z</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zu</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">• The residue theorem is employed in the design optimization of a vibrating structure. • The adjoint variable method is used for the design sensitivity computation. • Numerical examples demonstrate the computational efficiency of the optimization scheme. • High enhancement of the optimization process for the reduction of the radiated sound power.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Design sensitivity analysis</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Input power</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Vibro-acoustics</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Frequency averaging</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Residue theorem</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">D’Amico, Roberto</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Pluymers, Bert</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Desmet, Wim</subfield><subfield code="4">oth</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">Enthalten in</subfield><subfield code="n">Elsevier</subfield><subfield code="t">Conference Committee and Organizers</subfield><subfield code="d">2016</subfield><subfield code="d">an international journal</subfield><subfield code="g">Amsterdam [u.a.]</subfield><subfield code="w">(DE-627)ELV019856989</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:145</subfield><subfield code="g">year:2014</subfield><subfield code="g">pages:58-71</subfield><subfield code="g">extent:14</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.1016/j.compstruc.2014.08.005</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ELV</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_U</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">51.60</subfield><subfield code="j">Keramische Werkstoffe</subfield><subfield code="j">Hartstoffe</subfield><subfield code="x">Werkstoffkunde</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">58.45</subfield><subfield code="j">Gesteinshüttenkunde</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">145</subfield><subfield code="j">2014</subfield><subfield code="h">58-71</subfield><subfield code="g">14</subfield></datafield><datafield tag="953" ind1=" " ind2=" "><subfield code="2">045F</subfield><subfield code="a">004</subfield></datafield></record></collection>
|
| score |
7.4000053 |