Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins
Abstract The 15N steady-state magnetization in the presence of off-resonance rf irradiation is an analytical function of the T1/T2 ratio and of the angle between the 15N effective field axis and the static magnetic field direction. This relation holds whatever the relaxation mechanisms due to motion...
Ausführliche Beschreibung
Autor*in: |
---|
Format: |
E-Artikel |
---|---|
Sprache: |
Englisch |
Erschienen: |
1999 |
---|
Umfang: |
13 |
---|
Reproduktion: |
Springer Online Journal Archives 1860-2002 |
---|---|
Übergeordnetes Werk: |
in: Journal of biomolecular NMR - 1991, 15(1999) vom: Apr., Seite 295-307 |
Übergeordnetes Werk: |
volume:15 ; year:1999 ; month:04 ; pages:295-307 ; extent:13 |
Links: |
---|
Katalog-ID: |
NLEJ193326833 |
---|
LEADER | 01000caa a22002652 4500 | ||
---|---|---|---|
001 | NLEJ193326833 | ||
003 | DE-627 | ||
005 | 20210707205354.0 | ||
007 | cr uuu---uuuuu | ||
008 | 070526s1999 xx |||||o 00| ||eng c | ||
035 | |a (DE-627)NLEJ193326833 | ||
040 | |a DE-627 |b ger |c DE-627 |e rakwb | ||
041 | |a eng | ||
245 | 1 | 0 | |a Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins |
264 | 1 | |c 1999 | |
300 | |a 13 | ||
336 | |a nicht spezifiziert |b zzz |2 rdacontent | ||
337 | |a nicht spezifiziert |b z |2 rdamedia | ||
338 | |a nicht spezifiziert |b zu |2 rdacarrier | ||
520 | |a Abstract The 15N steady-state magnetization in the presence of off-resonance rf irradiation is an analytical function of the T1/T2 ratio and of the angle between the 15N effective field axis and the static magnetic field direction. This relation holds whatever the relaxation mechanisms due to motions on the nanosecond time scale, and the size of the spin system. If motions on the micro- to millisecond time scale are present (fast exchange), the same observable depends also on their spectral density at the frequency of the effective field. The cross-peak intensity in each 2D 15N-1H correlation map is directly related to the dynamic parameters, so that the characterization of fast exchange phenomena by this method is in principle less time-consuming than the separate measurement of self-relaxation rates. The theory of this approach is described. Its practical validity is experimentally evaluated on a 15N-labeled 61 amino acid neurotoxin. It turns out that existing equipments lead to non-negligible biases. Their consequences for the accuracy attainable, at present, by this method are investigated in detail. | ||
533 | |f Springer Online Journal Archives 1860-2002 | ||
700 | 1 | |a Guenneugues, Marc |4 oth | |
700 | 1 | |a Berthault, Patrick |4 oth | |
700 | 1 | |a Desvaux, Hervé |4 oth | |
700 | 1 | |a Goldman, Maurice |4 oth | |
773 | 0 | 8 | |i in |t Journal of biomolecular NMR |d 1991 |g 15(1999) vom: Apr., Seite 295-307 |w (DE-627)NLEJ188987630 |w (DE-600)2006645-4 |x 1573-5001 |7 nnns |
773 | 1 | 8 | |g volume:15 |g year:1999 |g month:04 |g pages:295-307 |g extent:13 |
856 | 4 | 0 | |u http://dx.doi.org/10.1023/A:1008355911556 |
912 | |a GBV_USEFLAG_U | ||
912 | |a ZDB-1-SOJ | ||
912 | |a GBV_NL_ARTICLE | ||
951 | |a AR | ||
952 | |d 15 |j 1999 |c 4 |h 295-307 |g 13 |
matchkey_str |
article:15735001:1999----::ieteemntooteeeoulattrtoyfrsnnetayttmgeiainesrmnivsiainfhpsilapiaino |
---|---|
hierarchy_sort_str |
1999 |
publishDate |
1999 |
allfields |
(DE-627)NLEJ193326833 DE-627 ger DE-627 rakwb eng Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins 1999 13 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Abstract The 15N steady-state magnetization in the presence of off-resonance rf irradiation is an analytical function of the T1/T2 ratio and of the angle between the 15N effective field axis and the static magnetic field direction. This relation holds whatever the relaxation mechanisms due to motions on the nanosecond time scale, and the size of the spin system. If motions on the micro- to millisecond time scale are present (fast exchange), the same observable depends also on their spectral density at the frequency of the effective field. The cross-peak intensity in each 2D 15N-1H correlation map is directly related to the dynamic parameters, so that the characterization of fast exchange phenomena by this method is in principle less time-consuming than the separate measurement of self-relaxation rates. The theory of this approach is described. Its practical validity is experimentally evaluated on a 15N-labeled 61 amino acid neurotoxin. It turns out that existing equipments lead to non-negligible biases. Their consequences for the accuracy attainable, at present, by this method are investigated in detail. Springer Online Journal Archives 1860-2002 Guenneugues, Marc oth Berthault, Patrick oth Desvaux, Hervé oth Goldman, Maurice oth in Journal of biomolecular NMR 1991 15(1999) vom: Apr., Seite 295-307 (DE-627)NLEJ188987630 (DE-600)2006645-4 1573-5001 nnns volume:15 year:1999 month:04 pages:295-307 extent:13 http://dx.doi.org/10.1023/A:1008355911556 GBV_USEFLAG_U ZDB-1-SOJ GBV_NL_ARTICLE AR 15 1999 4 295-307 13 |
spelling |
(DE-627)NLEJ193326833 DE-627 ger DE-627 rakwb eng Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins 1999 13 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Abstract The 15N steady-state magnetization in the presence of off-resonance rf irradiation is an analytical function of the T1/T2 ratio and of the angle between the 15N effective field axis and the static magnetic field direction. This relation holds whatever the relaxation mechanisms due to motions on the nanosecond time scale, and the size of the spin system. If motions on the micro- to millisecond time scale are present (fast exchange), the same observable depends also on their spectral density at the frequency of the effective field. The cross-peak intensity in each 2D 15N-1H correlation map is directly related to the dynamic parameters, so that the characterization of fast exchange phenomena by this method is in principle less time-consuming than the separate measurement of self-relaxation rates. The theory of this approach is described. Its practical validity is experimentally evaluated on a 15N-labeled 61 amino acid neurotoxin. It turns out that existing equipments lead to non-negligible biases. Their consequences for the accuracy attainable, at present, by this method are investigated in detail. Springer Online Journal Archives 1860-2002 Guenneugues, Marc oth Berthault, Patrick oth Desvaux, Hervé oth Goldman, Maurice oth in Journal of biomolecular NMR 1991 15(1999) vom: Apr., Seite 295-307 (DE-627)NLEJ188987630 (DE-600)2006645-4 1573-5001 nnns volume:15 year:1999 month:04 pages:295-307 extent:13 http://dx.doi.org/10.1023/A:1008355911556 GBV_USEFLAG_U ZDB-1-SOJ GBV_NL_ARTICLE AR 15 1999 4 295-307 13 |
allfields_unstemmed |
(DE-627)NLEJ193326833 DE-627 ger DE-627 rakwb eng Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins 1999 13 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Abstract The 15N steady-state magnetization in the presence of off-resonance rf irradiation is an analytical function of the T1/T2 ratio and of the angle between the 15N effective field axis and the static magnetic field direction. This relation holds whatever the relaxation mechanisms due to motions on the nanosecond time scale, and the size of the spin system. If motions on the micro- to millisecond time scale are present (fast exchange), the same observable depends also on their spectral density at the frequency of the effective field. The cross-peak intensity in each 2D 15N-1H correlation map is directly related to the dynamic parameters, so that the characterization of fast exchange phenomena by this method is in principle less time-consuming than the separate measurement of self-relaxation rates. The theory of this approach is described. Its practical validity is experimentally evaluated on a 15N-labeled 61 amino acid neurotoxin. It turns out that existing equipments lead to non-negligible biases. Their consequences for the accuracy attainable, at present, by this method are investigated in detail. Springer Online Journal Archives 1860-2002 Guenneugues, Marc oth Berthault, Patrick oth Desvaux, Hervé oth Goldman, Maurice oth in Journal of biomolecular NMR 1991 15(1999) vom: Apr., Seite 295-307 (DE-627)NLEJ188987630 (DE-600)2006645-4 1573-5001 nnns volume:15 year:1999 month:04 pages:295-307 extent:13 http://dx.doi.org/10.1023/A:1008355911556 GBV_USEFLAG_U ZDB-1-SOJ GBV_NL_ARTICLE AR 15 1999 4 295-307 13 |
allfieldsGer |
(DE-627)NLEJ193326833 DE-627 ger DE-627 rakwb eng Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins 1999 13 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Abstract The 15N steady-state magnetization in the presence of off-resonance rf irradiation is an analytical function of the T1/T2 ratio and of the angle between the 15N effective field axis and the static magnetic field direction. This relation holds whatever the relaxation mechanisms due to motions on the nanosecond time scale, and the size of the spin system. If motions on the micro- to millisecond time scale are present (fast exchange), the same observable depends also on their spectral density at the frequency of the effective field. The cross-peak intensity in each 2D 15N-1H correlation map is directly related to the dynamic parameters, so that the characterization of fast exchange phenomena by this method is in principle less time-consuming than the separate measurement of self-relaxation rates. The theory of this approach is described. Its practical validity is experimentally evaluated on a 15N-labeled 61 amino acid neurotoxin. It turns out that existing equipments lead to non-negligible biases. Their consequences for the accuracy attainable, at present, by this method are investigated in detail. Springer Online Journal Archives 1860-2002 Guenneugues, Marc oth Berthault, Patrick oth Desvaux, Hervé oth Goldman, Maurice oth in Journal of biomolecular NMR 1991 15(1999) vom: Apr., Seite 295-307 (DE-627)NLEJ188987630 (DE-600)2006645-4 1573-5001 nnns volume:15 year:1999 month:04 pages:295-307 extent:13 http://dx.doi.org/10.1023/A:1008355911556 GBV_USEFLAG_U ZDB-1-SOJ GBV_NL_ARTICLE AR 15 1999 4 295-307 13 |
allfieldsSound |
(DE-627)NLEJ193326833 DE-627 ger DE-627 rakwb eng Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins 1999 13 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier Abstract The 15N steady-state magnetization in the presence of off-resonance rf irradiation is an analytical function of the T1/T2 ratio and of the angle between the 15N effective field axis and the static magnetic field direction. This relation holds whatever the relaxation mechanisms due to motions on the nanosecond time scale, and the size of the spin system. If motions on the micro- to millisecond time scale are present (fast exchange), the same observable depends also on their spectral density at the frequency of the effective field. The cross-peak intensity in each 2D 15N-1H correlation map is directly related to the dynamic parameters, so that the characterization of fast exchange phenomena by this method is in principle less time-consuming than the separate measurement of self-relaxation rates. The theory of this approach is described. Its practical validity is experimentally evaluated on a 15N-labeled 61 amino acid neurotoxin. It turns out that existing equipments lead to non-negligible biases. Their consequences for the accuracy attainable, at present, by this method are investigated in detail. Springer Online Journal Archives 1860-2002 Guenneugues, Marc oth Berthault, Patrick oth Desvaux, Hervé oth Goldman, Maurice oth in Journal of biomolecular NMR 1991 15(1999) vom: Apr., Seite 295-307 (DE-627)NLEJ188987630 (DE-600)2006645-4 1573-5001 nnns volume:15 year:1999 month:04 pages:295-307 extent:13 http://dx.doi.org/10.1023/A:1008355911556 GBV_USEFLAG_U ZDB-1-SOJ GBV_NL_ARTICLE AR 15 1999 4 295-307 13 |
language |
English |
source |
in Journal of biomolecular NMR 15(1999) vom: Apr., Seite 295-307 volume:15 year:1999 month:04 pages:295-307 extent:13 |
sourceStr |
in Journal of biomolecular NMR 15(1999) vom: Apr., Seite 295-307 volume:15 year:1999 month:04 pages:295-307 extent:13 |
format_phy_str_mv |
Article |
institution |
findex.gbv.de |
isfreeaccess_bool |
false |
container_title |
Journal of biomolecular NMR |
authorswithroles_txt_mv |
Guenneugues, Marc @@oth@@ Berthault, Patrick @@oth@@ Desvaux, Hervé @@oth@@ Goldman, Maurice @@oth@@ |
publishDateDaySort_date |
1999-04-01T00:00:00Z |
hierarchy_top_id |
NLEJ188987630 |
id |
NLEJ193326833 |
language_de |
englisch |
fullrecord |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">NLEJ193326833</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20210707205354.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">070526s1999 xx |||||o 00| ||eng c</controlfield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)NLEJ193326833</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">1999</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">13</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zzz</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">z</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zu</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Abstract The 15N steady-state magnetization in the presence of off-resonance rf irradiation is an analytical function of the T1/T2 ratio and of the angle between the 15N effective field axis and the static magnetic field direction. This relation holds whatever the relaxation mechanisms due to motions on the nanosecond time scale, and the size of the spin system. If motions on the micro- to millisecond time scale are present (fast exchange), the same observable depends also on their spectral density at the frequency of the effective field. The cross-peak intensity in each 2D 15N-1H correlation map is directly related to the dynamic parameters, so that the characterization of fast exchange phenomena by this method is in principle less time-consuming than the separate measurement of self-relaxation rates. The theory of this approach is described. Its practical validity is experimentally evaluated on a 15N-labeled 61 amino acid neurotoxin. It turns out that existing equipments lead to non-negligible biases. Their consequences for the accuracy attainable, at present, by this method are investigated in detail.</subfield></datafield><datafield tag="533" ind1=" " ind2=" "><subfield code="f">Springer Online Journal Archives 1860-2002</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Guenneugues, Marc</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Berthault, Patrick</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Desvaux, Hervé</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Goldman, Maurice</subfield><subfield code="4">oth</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">in</subfield><subfield code="t">Journal of biomolecular NMR</subfield><subfield code="d">1991</subfield><subfield code="g">15(1999) vom: Apr., Seite 295-307</subfield><subfield code="w">(DE-627)NLEJ188987630</subfield><subfield code="w">(DE-600)2006645-4</subfield><subfield code="x">1573-5001</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:15</subfield><subfield code="g">year:1999</subfield><subfield code="g">month:04</subfield><subfield code="g">pages:295-307</subfield><subfield code="g">extent:13</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">http://dx.doi.org/10.1023/A:1008355911556</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-1-SOJ</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_NL_ARTICLE</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">15</subfield><subfield code="j">1999</subfield><subfield code="c">4</subfield><subfield code="h">295-307</subfield><subfield code="g">13</subfield></datafield></record></collection>
|
series2 |
Springer Online Journal Archives 1860-2002 |
ppnlink_with_tag_str_mv |
@@773@@(DE-627)NLEJ188987630 |
format |
electronic Article |
delete_txt_mv |
keep |
collection |
NL |
remote_str |
true |
illustrated |
Not Illustrated |
issn |
1573-5001 |
topic_title |
Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins |
format_facet |
Elektronische Aufsätze Aufsätze Elektronische Ressource |
format_main_str_mv |
Text Zeitschrift/Artikel |
carriertype_str_mv |
zu |
author2_variant |
m g mg p b pb h d hd m g mg |
hierarchy_parent_title |
Journal of biomolecular NMR |
hierarchy_parent_id |
NLEJ188987630 |
hierarchy_top_title |
Journal of biomolecular NMR |
isfreeaccess_txt |
false |
familylinks_str_mv |
(DE-627)NLEJ188987630 (DE-600)2006645-4 |
title |
Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins |
spellingShingle |
Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins |
ctrlnum |
(DE-627)NLEJ193326833 |
title_full |
Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins |
journal |
Journal of biomolecular NMR |
journalStr |
Journal of biomolecular NMR |
lang_code |
eng |
isOA_bool |
false |
recordtype |
marc |
publishDateSort |
1999 |
contenttype_str_mv |
zzz |
container_start_page |
295 |
container_volume |
15 |
physical |
13 |
format_se |
Elektronische Aufsätze |
title_sort |
direct determination of the heteronuclear t1/t2 ratio by off-resonance steady-state magnetization measurement: investigation of the possible application to fast exchange characterization of 15n-labeled proteins |
title_auth |
Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins |
abstract |
Abstract The 15N steady-state magnetization in the presence of off-resonance rf irradiation is an analytical function of the T1/T2 ratio and of the angle between the 15N effective field axis and the static magnetic field direction. This relation holds whatever the relaxation mechanisms due to motions on the nanosecond time scale, and the size of the spin system. If motions on the micro- to millisecond time scale are present (fast exchange), the same observable depends also on their spectral density at the frequency of the effective field. The cross-peak intensity in each 2D 15N-1H correlation map is directly related to the dynamic parameters, so that the characterization of fast exchange phenomena by this method is in principle less time-consuming than the separate measurement of self-relaxation rates. The theory of this approach is described. Its practical validity is experimentally evaluated on a 15N-labeled 61 amino acid neurotoxin. It turns out that existing equipments lead to non-negligible biases. Their consequences for the accuracy attainable, at present, by this method are investigated in detail. |
abstractGer |
Abstract The 15N steady-state magnetization in the presence of off-resonance rf irradiation is an analytical function of the T1/T2 ratio and of the angle between the 15N effective field axis and the static magnetic field direction. This relation holds whatever the relaxation mechanisms due to motions on the nanosecond time scale, and the size of the spin system. If motions on the micro- to millisecond time scale are present (fast exchange), the same observable depends also on their spectral density at the frequency of the effective field. The cross-peak intensity in each 2D 15N-1H correlation map is directly related to the dynamic parameters, so that the characterization of fast exchange phenomena by this method is in principle less time-consuming than the separate measurement of self-relaxation rates. The theory of this approach is described. Its practical validity is experimentally evaluated on a 15N-labeled 61 amino acid neurotoxin. It turns out that existing equipments lead to non-negligible biases. Their consequences for the accuracy attainable, at present, by this method are investigated in detail. |
abstract_unstemmed |
Abstract The 15N steady-state magnetization in the presence of off-resonance rf irradiation is an analytical function of the T1/T2 ratio and of the angle between the 15N effective field axis and the static magnetic field direction. This relation holds whatever the relaxation mechanisms due to motions on the nanosecond time scale, and the size of the spin system. If motions on the micro- to millisecond time scale are present (fast exchange), the same observable depends also on their spectral density at the frequency of the effective field. The cross-peak intensity in each 2D 15N-1H correlation map is directly related to the dynamic parameters, so that the characterization of fast exchange phenomena by this method is in principle less time-consuming than the separate measurement of self-relaxation rates. The theory of this approach is described. Its practical validity is experimentally evaluated on a 15N-labeled 61 amino acid neurotoxin. It turns out that existing equipments lead to non-negligible biases. Their consequences for the accuracy attainable, at present, by this method are investigated in detail. |
collection_details |
GBV_USEFLAG_U ZDB-1-SOJ GBV_NL_ARTICLE |
title_short |
Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins |
url |
http://dx.doi.org/10.1023/A:1008355911556 |
remote_bool |
true |
author2 |
Guenneugues, Marc Berthault, Patrick Desvaux, Hervé Goldman, Maurice |
author2Str |
Guenneugues, Marc Berthault, Patrick Desvaux, Hervé Goldman, Maurice |
ppnlink |
NLEJ188987630 |
mediatype_str_mv |
z |
isOA_txt |
false |
hochschulschrift_bool |
false |
author2_role |
oth oth oth oth |
up_date |
2024-07-05T21:22:32.784Z |
_version_ |
1803775694900035584 |
fullrecord_marcxml |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">NLEJ193326833</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20210707205354.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">070526s1999 xx |||||o 00| ||eng c</controlfield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)NLEJ193326833</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Direct determination of the heteronuclear T1/T2 ratio by off-resonance steady-state magnetization measurement: Investigation of the possible application to fast exchange characterization of 15N-labeled proteins</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">1999</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">13</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zzz</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">z</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zu</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Abstract The 15N steady-state magnetization in the presence of off-resonance rf irradiation is an analytical function of the T1/T2 ratio and of the angle between the 15N effective field axis and the static magnetic field direction. This relation holds whatever the relaxation mechanisms due to motions on the nanosecond time scale, and the size of the spin system. If motions on the micro- to millisecond time scale are present (fast exchange), the same observable depends also on their spectral density at the frequency of the effective field. The cross-peak intensity in each 2D 15N-1H correlation map is directly related to the dynamic parameters, so that the characterization of fast exchange phenomena by this method is in principle less time-consuming than the separate measurement of self-relaxation rates. The theory of this approach is described. Its practical validity is experimentally evaluated on a 15N-labeled 61 amino acid neurotoxin. It turns out that existing equipments lead to non-negligible biases. Their consequences for the accuracy attainable, at present, by this method are investigated in detail.</subfield></datafield><datafield tag="533" ind1=" " ind2=" "><subfield code="f">Springer Online Journal Archives 1860-2002</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Guenneugues, Marc</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Berthault, Patrick</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Desvaux, Hervé</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Goldman, Maurice</subfield><subfield code="4">oth</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">in</subfield><subfield code="t">Journal of biomolecular NMR</subfield><subfield code="d">1991</subfield><subfield code="g">15(1999) vom: Apr., Seite 295-307</subfield><subfield code="w">(DE-627)NLEJ188987630</subfield><subfield code="w">(DE-600)2006645-4</subfield><subfield code="x">1573-5001</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:15</subfield><subfield code="g">year:1999</subfield><subfield code="g">month:04</subfield><subfield code="g">pages:295-307</subfield><subfield code="g">extent:13</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">http://dx.doi.org/10.1023/A:1008355911556</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-1-SOJ</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_NL_ARTICLE</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">15</subfield><subfield code="j">1999</subfield><subfield code="c">4</subfield><subfield code="h">295-307</subfield><subfield code="g">13</subfield></datafield></record></collection>
|
score |
7.3986187 |