Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers

Background Grain amaranth (Amaranthus spp.) has been cultivated since ancient times in some countries in the world and it is one of the oldest food crops. At present, the crop has gained more importance in the plains of India, especially in parts of Gujarat and Maharashtra. Grain amaranth exhibits a...
Ausführliche Beschreibung

Gespeichert in:

Autor*in:	Gelotar, Mayuri J. [verfasserIn] Dharajiya, Darshan T. Solanki, S. D. Prajapati, N. N. Tiwari, Kapil K.

Format:	E-Artikel
Sprache:	Englisch

Erschienen:	2019

Schlagwörter:	Grain amaranth spp. ISSR Genetic diversity Molecular markers

Anmerkung:	© The Author(s) 2019

Übergeordnetes Werk:	Enthalten in: Bulletin of the National Research Centre - Berlin : Springer, 2018, 43(2019), 1 vom: 26. Juni
Übergeordnetes Werk:	volume:43 ; year:2019 ; number:1 ; day:26 ; month:06

Links:	Volltext

DOI / URN:	10.1186/s42269-019-0146-2

Katalog-ID:	SPR038512920

Internformat


LEADER	01000caa a22002652 4500
001	SPR038512920
003	DE-627
005	20230328214524.0
007	cr uuu---uuuuu
008	201007s2019 xx \|\|\|\|\|o 00\| \|\|eng c
024	7		\|a 10.1186/s42269-019-0146-2 \|2 doi
035			\|a (DE-627)SPR038512920
035			\|a (SPR)s42269-019-0146-2-e
040			\|a DE-627 \|b ger \|c DE-627 \|e rakwb
041			\|a eng
100	1		\|a Gelotar, Mayuri J. \|e verfasserin \|4 aut
245	1	0	\|a Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers
264		1	\|c 2019
336			\|a Text \|b txt \|2 rdacontent
337			\|a Computermedien \|b c \|2 rdamedia
338			\|a Online-Ressource \|b cr \|2 rdacarrier
500			\|a © The Author(s) 2019
520			\|a Background Grain amaranth (Amaranthus spp.) has been cultivated since ancient times in some countries in the world and it is one of the oldest food crops. At present, the crop has gained more importance in the plains of India, especially in parts of Gujarat and Maharashtra. Grain amaranth exhibits an incredible extent of morphological diversity and an extensive adaptability to diverse eco-geographical conditions. Hence, the aim of the recent research was to evaluate the genetic diversity of 19 genotypes from four diverse species of Amaranthus from India using ISSR markers. Results The set of 11 polymorphic ISSR primers produced a total of 114 amplicons, among which 98 amplicons were polymorphic. The mean number of polymorphic amplicons per primer was 8.91. Overall, the size of PCR-amplified DNA fragments ranged from 200 to 3702 bp. The average percent polymorphism was 87.15%, and the average PIC value was 0.853, which indicates good selection of primers in the present study for the assessment of genetic diversity. The unique amplicon (marker)-producing primers were also found which can be used for identification of genotypes. The dendrogram grouped 19 grain amaranth genotypes into two major clusters. The groups formed on the principle component analysis (PCA) plot resembles with the results of the dendrogram although some genotypes have been diverted on the PCA plot. Conclusions The technique may be used to obtain reasonably precise information on the genetic relationship among grain amaranth genotypes. Such information may be useful for selecting the diverse parents and monitoring the genetic diversity periodically in the breeder’s working collection of grain amaranth.
650		4	\|a Grain amaranth \|7 (dpeaa)DE-He213
650		4	\|a spp. \|7 (dpeaa)DE-He213
650		4	\|a ISSR \|7 (dpeaa)DE-He213
650		4	\|a Genetic diversity \|7 (dpeaa)DE-He213
650		4	\|a Molecular markers \|7 (dpeaa)DE-He213
700	1		\|a Dharajiya, Darshan T. \|0 (orcid)0000-0001-5360-4631 \|4 aut
700	1		\|a Solanki, S. D. \|4 aut
700	1		\|a Prajapati, N. N. \|4 aut
700	1		\|a Tiwari, Kapil K. \|4 aut
773	0	8	\|i Enthalten in \|t Bulletin of the National Research Centre \|d Berlin : Springer, 2018 \|g 43(2019), 1 vom: 26. Juni \|w (DE-627)1035877007 \|w (DE-600)2946659-3 \|x 2522-8307 \|7 nnns
773	1	8	\|g volume:43 \|g year:2019 \|g number:1 \|g day:26 \|g month:06
856	4	0	\|u https://dx.doi.org/10.1186/s42269-019-0146-2 \|z kostenfrei \|3 Volltext
912			\|a GBV_USEFLAG_A
912			\|a SYSFLAG_A
912			\|a GBV_SPRINGER
912			\|a GBV_ILN_11
912			\|a GBV_ILN_20
912			\|a GBV_ILN_22
912			\|a GBV_ILN_23
912			\|a GBV_ILN_24
912			\|a GBV_ILN_31
912			\|a GBV_ILN_39
912			\|a GBV_ILN_40
912			\|a GBV_ILN_60
912			\|a GBV_ILN_62
912			\|a GBV_ILN_63
912			\|a GBV_ILN_65
912			\|a GBV_ILN_69
912			\|a GBV_ILN_70
912			\|a GBV_ILN_73
912			\|a GBV_ILN_95
912			\|a GBV_ILN_105
912			\|a GBV_ILN_110
912			\|a GBV_ILN_151
912			\|a GBV_ILN_161
912			\|a GBV_ILN_170
912			\|a GBV_ILN_171
912			\|a GBV_ILN_213
912			\|a GBV_ILN_230
912			\|a GBV_ILN_285
912			\|a GBV_ILN_293
912			\|a GBV_ILN_370
912			\|a GBV_ILN_602
912			\|a GBV_ILN_2005
912			\|a GBV_ILN_2009
912			\|a GBV_ILN_2014
912			\|a GBV_ILN_2055
912			\|a GBV_ILN_2111
912			\|a GBV_ILN_4012
912			\|a GBV_ILN_4037
912			\|a GBV_ILN_4112
912			\|a GBV_ILN_4125
912			\|a GBV_ILN_4126
912			\|a GBV_ILN_4249
912			\|a GBV_ILN_4305
912			\|a GBV_ILN_4306
912			\|a GBV_ILN_4307
912			\|a GBV_ILN_4313
912			\|a GBV_ILN_4322
912			\|a GBV_ILN_4323
912			\|a GBV_ILN_4324
912			\|a GBV_ILN_4325
912			\|a GBV_ILN_4335
912			\|a GBV_ILN_4338
912			\|a GBV_ILN_4367
912			\|a GBV_ILN_4700
951			\|a AR
952			\|d 43 \|j 2019 \|e 1 \|b 26 \|c 06

Indexfelder

author_variant	m j g mj mjg d t d dt dtd s d s sd sds n n p nn nnp k k t kk kkt
matchkey_str	article:25228307:2019----::eeidvriynlssnmlclrhrceiainfriaaatgntpssnitr
hierarchy_sort_str	2019
publishDate	2019
allfields	10.1186/s42269-019-0146-2 doi (DE-627)SPR038512920 (SPR)s42269-019-0146-2-e DE-627 ger DE-627 rakwb eng Gelotar, Mayuri J. verfasserin aut Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers 2019 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier © The Author(s) 2019 Background Grain amaranth (Amaranthus spp.) has been cultivated since ancient times in some countries in the world and it is one of the oldest food crops. At present, the crop has gained more importance in the plains of India, especially in parts of Gujarat and Maharashtra. Grain amaranth exhibits an incredible extent of morphological diversity and an extensive adaptability to diverse eco-geographical conditions. Hence, the aim of the recent research was to evaluate the genetic diversity of 19 genotypes from four diverse species of Amaranthus from India using ISSR markers. Results The set of 11 polymorphic ISSR primers produced a total of 114 amplicons, among which 98 amplicons were polymorphic. The mean number of polymorphic amplicons per primer was 8.91. Overall, the size of PCR-amplified DNA fragments ranged from 200 to 3702 bp. The average percent polymorphism was 87.15%, and the average PIC value was 0.853, which indicates good selection of primers in the present study for the assessment of genetic diversity. The unique amplicon (marker)-producing primers were also found which can be used for identification of genotypes. The dendrogram grouped 19 grain amaranth genotypes into two major clusters. The groups formed on the principle component analysis (PCA) plot resembles with the results of the dendrogram although some genotypes have been diverted on the PCA plot. Conclusions The technique may be used to obtain reasonably precise information on the genetic relationship among grain amaranth genotypes. Such information may be useful for selecting the diverse parents and monitoring the genetic diversity periodically in the breeder’s working collection of grain amaranth. Grain amaranth (dpeaa)DE-He213 spp. (dpeaa)DE-He213 ISSR (dpeaa)DE-He213 Genetic diversity (dpeaa)DE-He213 Molecular markers (dpeaa)DE-He213 Dharajiya, Darshan T. (orcid)0000-0001-5360-4631 aut Solanki, S. D. aut Prajapati, N. N. aut Tiwari, Kapil K. aut Enthalten in Bulletin of the National Research Centre Berlin : Springer, 2018 43(2019), 1 vom: 26. Juni (DE-627)1035877007 (DE-600)2946659-3 2522-8307 nnns volume:43 year:2019 number:1 day:26 month:06 https://dx.doi.org/10.1186/s42269-019-0146-2 kostenfrei Volltext GBV_USEFLAG_A SYSFLAG_A GBV_SPRINGER GBV_ILN_11 GBV_ILN_20 GBV_ILN_22 GBV_ILN_23 GBV_ILN_24 GBV_ILN_31 GBV_ILN_39 GBV_ILN_40 GBV_ILN_60 GBV_ILN_62 GBV_ILN_63 GBV_ILN_65 GBV_ILN_69 GBV_ILN_70 GBV_ILN_73 GBV_ILN_95 GBV_ILN_105 GBV_ILN_110 GBV_ILN_151 GBV_ILN_161 GBV_ILN_170 GBV_ILN_171 GBV_ILN_213 GBV_ILN_230 GBV_ILN_285 GBV_ILN_293 GBV_ILN_370 GBV_ILN_602 GBV_ILN_2005 GBV_ILN_2009 GBV_ILN_2014 GBV_ILN_2055 GBV_ILN_2111 GBV_ILN_4012 GBV_ILN_4037 GBV_ILN_4112 GBV_ILN_4125 GBV_ILN_4126 GBV_ILN_4249 GBV_ILN_4305 GBV_ILN_4306 GBV_ILN_4307 GBV_ILN_4313 GBV_ILN_4322 GBV_ILN_4323 GBV_ILN_4324 GBV_ILN_4325 GBV_ILN_4335 GBV_ILN_4338 GBV_ILN_4367 GBV_ILN_4700 AR 43 2019 1 26 06
spelling	10.1186/s42269-019-0146-2 doi (DE-627)SPR038512920 (SPR)s42269-019-0146-2-e DE-627 ger DE-627 rakwb eng Gelotar, Mayuri J. verfasserin aut Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers 2019 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier © The Author(s) 2019 Background Grain amaranth (Amaranthus spp.) has been cultivated since ancient times in some countries in the world and it is one of the oldest food crops. At present, the crop has gained more importance in the plains of India, especially in parts of Gujarat and Maharashtra. Grain amaranth exhibits an incredible extent of morphological diversity and an extensive adaptability to diverse eco-geographical conditions. Hence, the aim of the recent research was to evaluate the genetic diversity of 19 genotypes from four diverse species of Amaranthus from India using ISSR markers. Results The set of 11 polymorphic ISSR primers produced a total of 114 amplicons, among which 98 amplicons were polymorphic. The mean number of polymorphic amplicons per primer was 8.91. Overall, the size of PCR-amplified DNA fragments ranged from 200 to 3702 bp. The average percent polymorphism was 87.15%, and the average PIC value was 0.853, which indicates good selection of primers in the present study for the assessment of genetic diversity. The unique amplicon (marker)-producing primers were also found which can be used for identification of genotypes. The dendrogram grouped 19 grain amaranth genotypes into two major clusters. The groups formed on the principle component analysis (PCA) plot resembles with the results of the dendrogram although some genotypes have been diverted on the PCA plot. Conclusions The technique may be used to obtain reasonably precise information on the genetic relationship among grain amaranth genotypes. Such information may be useful for selecting the diverse parents and monitoring the genetic diversity periodically in the breeder’s working collection of grain amaranth. Grain amaranth (dpeaa)DE-He213 spp. (dpeaa)DE-He213 ISSR (dpeaa)DE-He213 Genetic diversity (dpeaa)DE-He213 Molecular markers (dpeaa)DE-He213 Dharajiya, Darshan T. (orcid)0000-0001-5360-4631 aut Solanki, S. D. aut Prajapati, N. N. aut Tiwari, Kapil K. aut Enthalten in Bulletin of the National Research Centre Berlin : Springer, 2018 43(2019), 1 vom: 26. Juni (DE-627)1035877007 (DE-600)2946659-3 2522-8307 nnns volume:43 year:2019 number:1 day:26 month:06 https://dx.doi.org/10.1186/s42269-019-0146-2 kostenfrei Volltext GBV_USEFLAG_A SYSFLAG_A GBV_SPRINGER GBV_ILN_11 GBV_ILN_20 GBV_ILN_22 GBV_ILN_23 GBV_ILN_24 GBV_ILN_31 GBV_ILN_39 GBV_ILN_40 GBV_ILN_60 GBV_ILN_62 GBV_ILN_63 GBV_ILN_65 GBV_ILN_69 GBV_ILN_70 GBV_ILN_73 GBV_ILN_95 GBV_ILN_105 GBV_ILN_110 GBV_ILN_151 GBV_ILN_161 GBV_ILN_170 GBV_ILN_171 GBV_ILN_213 GBV_ILN_230 GBV_ILN_285 GBV_ILN_293 GBV_ILN_370 GBV_ILN_602 GBV_ILN_2005 GBV_ILN_2009 GBV_ILN_2014 GBV_ILN_2055 GBV_ILN_2111 GBV_ILN_4012 GBV_ILN_4037 GBV_ILN_4112 GBV_ILN_4125 GBV_ILN_4126 GBV_ILN_4249 GBV_ILN_4305 GBV_ILN_4306 GBV_ILN_4307 GBV_ILN_4313 GBV_ILN_4322 GBV_ILN_4323 GBV_ILN_4324 GBV_ILN_4325 GBV_ILN_4335 GBV_ILN_4338 GBV_ILN_4367 GBV_ILN_4700 AR 43 2019 1 26 06
allfields_unstemmed	10.1186/s42269-019-0146-2 doi (DE-627)SPR038512920 (SPR)s42269-019-0146-2-e DE-627 ger DE-627 rakwb eng Gelotar, Mayuri J. verfasserin aut Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers 2019 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier © The Author(s) 2019 Background Grain amaranth (Amaranthus spp.) has been cultivated since ancient times in some countries in the world and it is one of the oldest food crops. At present, the crop has gained more importance in the plains of India, especially in parts of Gujarat and Maharashtra. Grain amaranth exhibits an incredible extent of morphological diversity and an extensive adaptability to diverse eco-geographical conditions. Hence, the aim of the recent research was to evaluate the genetic diversity of 19 genotypes from four diverse species of Amaranthus from India using ISSR markers. Results The set of 11 polymorphic ISSR primers produced a total of 114 amplicons, among which 98 amplicons were polymorphic. The mean number of polymorphic amplicons per primer was 8.91. Overall, the size of PCR-amplified DNA fragments ranged from 200 to 3702 bp. The average percent polymorphism was 87.15%, and the average PIC value was 0.853, which indicates good selection of primers in the present study for the assessment of genetic diversity. The unique amplicon (marker)-producing primers were also found which can be used for identification of genotypes. The dendrogram grouped 19 grain amaranth genotypes into two major clusters. The groups formed on the principle component analysis (PCA) plot resembles with the results of the dendrogram although some genotypes have been diverted on the PCA plot. Conclusions The technique may be used to obtain reasonably precise information on the genetic relationship among grain amaranth genotypes. Such information may be useful for selecting the diverse parents and monitoring the genetic diversity periodically in the breeder’s working collection of grain amaranth. Grain amaranth (dpeaa)DE-He213 spp. (dpeaa)DE-He213 ISSR (dpeaa)DE-He213 Genetic diversity (dpeaa)DE-He213 Molecular markers (dpeaa)DE-He213 Dharajiya, Darshan T. (orcid)0000-0001-5360-4631 aut Solanki, S. D. aut Prajapati, N. N. aut Tiwari, Kapil K. aut Enthalten in Bulletin of the National Research Centre Berlin : Springer, 2018 43(2019), 1 vom: 26. Juni (DE-627)1035877007 (DE-600)2946659-3 2522-8307 nnns volume:43 year:2019 number:1 day:26 month:06 https://dx.doi.org/10.1186/s42269-019-0146-2 kostenfrei Volltext GBV_USEFLAG_A SYSFLAG_A GBV_SPRINGER GBV_ILN_11 GBV_ILN_20 GBV_ILN_22 GBV_ILN_23 GBV_ILN_24 GBV_ILN_31 GBV_ILN_39 GBV_ILN_40 GBV_ILN_60 GBV_ILN_62 GBV_ILN_63 GBV_ILN_65 GBV_ILN_69 GBV_ILN_70 GBV_ILN_73 GBV_ILN_95 GBV_ILN_105 GBV_ILN_110 GBV_ILN_151 GBV_ILN_161 GBV_ILN_170 GBV_ILN_171 GBV_ILN_213 GBV_ILN_230 GBV_ILN_285 GBV_ILN_293 GBV_ILN_370 GBV_ILN_602 GBV_ILN_2005 GBV_ILN_2009 GBV_ILN_2014 GBV_ILN_2055 GBV_ILN_2111 GBV_ILN_4012 GBV_ILN_4037 GBV_ILN_4112 GBV_ILN_4125 GBV_ILN_4126 GBV_ILN_4249 GBV_ILN_4305 GBV_ILN_4306 GBV_ILN_4307 GBV_ILN_4313 GBV_ILN_4322 GBV_ILN_4323 GBV_ILN_4324 GBV_ILN_4325 GBV_ILN_4335 GBV_ILN_4338 GBV_ILN_4367 GBV_ILN_4700 AR 43 2019 1 26 06
allfieldsGer	10.1186/s42269-019-0146-2 doi (DE-627)SPR038512920 (SPR)s42269-019-0146-2-e DE-627 ger DE-627 rakwb eng Gelotar, Mayuri J. verfasserin aut Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers 2019 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier © The Author(s) 2019 Background Grain amaranth (Amaranthus spp.) has been cultivated since ancient times in some countries in the world and it is one of the oldest food crops. At present, the crop has gained more importance in the plains of India, especially in parts of Gujarat and Maharashtra. Grain amaranth exhibits an incredible extent of morphological diversity and an extensive adaptability to diverse eco-geographical conditions. Hence, the aim of the recent research was to evaluate the genetic diversity of 19 genotypes from four diverse species of Amaranthus from India using ISSR markers. Results The set of 11 polymorphic ISSR primers produced a total of 114 amplicons, among which 98 amplicons were polymorphic. The mean number of polymorphic amplicons per primer was 8.91. Overall, the size of PCR-amplified DNA fragments ranged from 200 to 3702 bp. The average percent polymorphism was 87.15%, and the average PIC value was 0.853, which indicates good selection of primers in the present study for the assessment of genetic diversity. The unique amplicon (marker)-producing primers were also found which can be used for identification of genotypes. The dendrogram grouped 19 grain amaranth genotypes into two major clusters. The groups formed on the principle component analysis (PCA) plot resembles with the results of the dendrogram although some genotypes have been diverted on the PCA plot. Conclusions The technique may be used to obtain reasonably precise information on the genetic relationship among grain amaranth genotypes. Such information may be useful for selecting the diverse parents and monitoring the genetic diversity periodically in the breeder’s working collection of grain amaranth. Grain amaranth (dpeaa)DE-He213 spp. (dpeaa)DE-He213 ISSR (dpeaa)DE-He213 Genetic diversity (dpeaa)DE-He213 Molecular markers (dpeaa)DE-He213 Dharajiya, Darshan T. (orcid)0000-0001-5360-4631 aut Solanki, S. D. aut Prajapati, N. N. aut Tiwari, Kapil K. aut Enthalten in Bulletin of the National Research Centre Berlin : Springer, 2018 43(2019), 1 vom: 26. Juni (DE-627)1035877007 (DE-600)2946659-3 2522-8307 nnns volume:43 year:2019 number:1 day:26 month:06 https://dx.doi.org/10.1186/s42269-019-0146-2 kostenfrei Volltext GBV_USEFLAG_A SYSFLAG_A GBV_SPRINGER GBV_ILN_11 GBV_ILN_20 GBV_ILN_22 GBV_ILN_23 GBV_ILN_24 GBV_ILN_31 GBV_ILN_39 GBV_ILN_40 GBV_ILN_60 GBV_ILN_62 GBV_ILN_63 GBV_ILN_65 GBV_ILN_69 GBV_ILN_70 GBV_ILN_73 GBV_ILN_95 GBV_ILN_105 GBV_ILN_110 GBV_ILN_151 GBV_ILN_161 GBV_ILN_170 GBV_ILN_171 GBV_ILN_213 GBV_ILN_230 GBV_ILN_285 GBV_ILN_293 GBV_ILN_370 GBV_ILN_602 GBV_ILN_2005 GBV_ILN_2009 GBV_ILN_2014 GBV_ILN_2055 GBV_ILN_2111 GBV_ILN_4012 GBV_ILN_4037 GBV_ILN_4112 GBV_ILN_4125 GBV_ILN_4126 GBV_ILN_4249 GBV_ILN_4305 GBV_ILN_4306 GBV_ILN_4307 GBV_ILN_4313 GBV_ILN_4322 GBV_ILN_4323 GBV_ILN_4324 GBV_ILN_4325 GBV_ILN_4335 GBV_ILN_4338 GBV_ILN_4367 GBV_ILN_4700 AR 43 2019 1 26 06
allfieldsSound	10.1186/s42269-019-0146-2 doi (DE-627)SPR038512920 (SPR)s42269-019-0146-2-e DE-627 ger DE-627 rakwb eng Gelotar, Mayuri J. verfasserin aut Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers 2019 Text txt rdacontent Computermedien c rdamedia Online-Ressource cr rdacarrier © The Author(s) 2019 Background Grain amaranth (Amaranthus spp.) has been cultivated since ancient times in some countries in the world and it is one of the oldest food crops. At present, the crop has gained more importance in the plains of India, especially in parts of Gujarat and Maharashtra. Grain amaranth exhibits an incredible extent of morphological diversity and an extensive adaptability to diverse eco-geographical conditions. Hence, the aim of the recent research was to evaluate the genetic diversity of 19 genotypes from four diverse species of Amaranthus from India using ISSR markers. Results The set of 11 polymorphic ISSR primers produced a total of 114 amplicons, among which 98 amplicons were polymorphic. The mean number of polymorphic amplicons per primer was 8.91. Overall, the size of PCR-amplified DNA fragments ranged from 200 to 3702 bp. The average percent polymorphism was 87.15%, and the average PIC value was 0.853, which indicates good selection of primers in the present study for the assessment of genetic diversity. The unique amplicon (marker)-producing primers were also found which can be used for identification of genotypes. The dendrogram grouped 19 grain amaranth genotypes into two major clusters. The groups formed on the principle component analysis (PCA) plot resembles with the results of the dendrogram although some genotypes have been diverted on the PCA plot. Conclusions The technique may be used to obtain reasonably precise information on the genetic relationship among grain amaranth genotypes. Such information may be useful for selecting the diverse parents and monitoring the genetic diversity periodically in the breeder’s working collection of grain amaranth. Grain amaranth (dpeaa)DE-He213 spp. (dpeaa)DE-He213 ISSR (dpeaa)DE-He213 Genetic diversity (dpeaa)DE-He213 Molecular markers (dpeaa)DE-He213 Dharajiya, Darshan T. (orcid)0000-0001-5360-4631 aut Solanki, S. D. aut Prajapati, N. N. aut Tiwari, Kapil K. aut Enthalten in Bulletin of the National Research Centre Berlin : Springer, 2018 43(2019), 1 vom: 26. Juni (DE-627)1035877007 (DE-600)2946659-3 2522-8307 nnns volume:43 year:2019 number:1 day:26 month:06 https://dx.doi.org/10.1186/s42269-019-0146-2 kostenfrei Volltext GBV_USEFLAG_A SYSFLAG_A GBV_SPRINGER GBV_ILN_11 GBV_ILN_20 GBV_ILN_22 GBV_ILN_23 GBV_ILN_24 GBV_ILN_31 GBV_ILN_39 GBV_ILN_40 GBV_ILN_60 GBV_ILN_62 GBV_ILN_63 GBV_ILN_65 GBV_ILN_69 GBV_ILN_70 GBV_ILN_73 GBV_ILN_95 GBV_ILN_105 GBV_ILN_110 GBV_ILN_151 GBV_ILN_161 GBV_ILN_170 GBV_ILN_171 GBV_ILN_213 GBV_ILN_230 GBV_ILN_285 GBV_ILN_293 GBV_ILN_370 GBV_ILN_602 GBV_ILN_2005 GBV_ILN_2009 GBV_ILN_2014 GBV_ILN_2055 GBV_ILN_2111 GBV_ILN_4012 GBV_ILN_4037 GBV_ILN_4112 GBV_ILN_4125 GBV_ILN_4126 GBV_ILN_4249 GBV_ILN_4305 GBV_ILN_4306 GBV_ILN_4307 GBV_ILN_4313 GBV_ILN_4322 GBV_ILN_4323 GBV_ILN_4324 GBV_ILN_4325 GBV_ILN_4335 GBV_ILN_4338 GBV_ILN_4367 GBV_ILN_4700 AR 43 2019 1 26 06
language	English
source	Enthalten in Bulletin of the National Research Centre 43(2019), 1 vom: 26. Juni volume:43 year:2019 number:1 day:26 month:06
sourceStr	Enthalten in Bulletin of the National Research Centre 43(2019), 1 vom: 26. Juni volume:43 year:2019 number:1 day:26 month:06
format_phy_str_mv	Article
institution	findex.gbv.de
topic_facet	Grain amaranth spp. ISSR Genetic diversity Molecular markers
isfreeaccess_bool	true
container_title	Bulletin of the National Research Centre
authorswithroles_txt_mv	Gelotar, Mayuri J. @@aut@@ Dharajiya, Darshan T. @@aut@@ Solanki, S. D. @@aut@@ Prajapati, N. N. @@aut@@ Tiwari, Kapil K. @@aut@@
publishDateDaySort_date	2019-06-26T00:00:00Z
hierarchy_top_id	1035877007
id	SPR038512920
language_de	englisch
fullrecord	<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">SPR038512920</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230328214524.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">201007s2019 xx \|\|\|\|\|o 00\| \|\|eng c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1186/s42269-019-0146-2</subfield><subfield code="2">doi</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)SPR038512920</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(SPR)s42269-019-0146-2-e</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Gelotar, Mayuri J.</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2019</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">Text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">Computermedien</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">Online-Ressource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">© The Author(s) 2019</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Background Grain amaranth (Amaranthus spp.) has been cultivated since ancient times in some countries in the world and it is one of the oldest food crops. At present, the crop has gained more importance in the plains of India, especially in parts of Gujarat and Maharashtra. Grain amaranth exhibits an incredible extent of morphological diversity and an extensive adaptability to diverse eco-geographical conditions. Hence, the aim of the recent research was to evaluate the genetic diversity of 19 genotypes from four diverse species of Amaranthus from India using ISSR markers. Results The set of 11 polymorphic ISSR primers produced a total of 114 amplicons, among which 98 amplicons were polymorphic. The mean number of polymorphic amplicons per primer was 8.91. Overall, the size of PCR-amplified DNA fragments ranged from 200 to 3702 bp. The average percent polymorphism was 87.15%, and the average PIC value was 0.853, which indicates good selection of primers in the present study for the assessment of genetic diversity. The unique amplicon (marker)-producing primers were also found which can be used for identification of genotypes. The dendrogram grouped 19 grain amaranth genotypes into two major clusters. The groups formed on the principle component analysis (PCA) plot resembles with the results of the dendrogram although some genotypes have been diverted on the PCA plot. Conclusions The technique may be used to obtain reasonably precise information on the genetic relationship among grain amaranth genotypes. Such information may be useful for selecting the diverse parents and monitoring the genetic diversity periodically in the breeder’s working collection of grain amaranth.</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Grain amaranth</subfield><subfield code="7">(dpeaa)DE-He213</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">spp.</subfield><subfield code="7">(dpeaa)DE-He213</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">ISSR</subfield><subfield code="7">(dpeaa)DE-He213</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Genetic diversity</subfield><subfield code="7">(dpeaa)DE-He213</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Molecular markers</subfield><subfield code="7">(dpeaa)DE-He213</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Dharajiya, Darshan T.</subfield><subfield code="0">(orcid)0000-0001-5360-4631</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Solanki, S. D.</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Prajapati, N. N.</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Tiwari, Kapil K.</subfield><subfield code="4">aut</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">Enthalten in</subfield><subfield code="t">Bulletin of the National Research Centre</subfield><subfield code="d">Berlin : Springer, 2018</subfield><subfield code="g">43(2019), 1 vom: 26. Juni</subfield><subfield code="w">(DE-627)1035877007</subfield><subfield code="w">(DE-600)2946659-3</subfield><subfield code="x">2522-8307</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:43</subfield><subfield code="g">year:2019</subfield><subfield code="g">number:1</subfield><subfield code="g">day:26</subfield><subfield code="g">month:06</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://dx.doi.org/10.1186/s42269-019-0146-2</subfield><subfield code="z">kostenfrei</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_SPRINGER</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_11</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_20</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_22</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_23</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_24</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_31</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_39</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_40</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_60</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_62</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_63</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_65</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_69</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_70</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_73</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_95</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_105</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_110</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_151</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_161</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_170</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_171</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_213</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_230</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_285</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_293</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_370</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_602</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2005</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2009</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2014</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2055</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2111</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4012</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4037</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4112</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4125</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4126</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4249</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4305</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4306</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4307</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4313</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4322</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4323</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4324</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4325</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4335</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4338</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4367</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4700</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">43</subfield><subfield code="j">2019</subfield><subfield code="e">1</subfield><subfield code="b">26</subfield><subfield code="c">06</subfield></datafield></record></collection>
author	Gelotar, Mayuri J.
spellingShingle	Gelotar, Mayuri J. misc Grain amaranth misc spp. misc ISSR misc Genetic diversity misc Molecular markers Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers
authorStr	Gelotar, Mayuri J.
ppnlink_with_tag_str_mv	@@773@@(DE-627)1035877007
format	electronic Article
delete_txt_mv	keep
author_role	aut aut aut aut aut
collection	springer
remote_str	true
illustrated	Not Illustrated
issn	2522-8307
topic_title	Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers Grain amaranth (dpeaa)DE-He213 spp. (dpeaa)DE-He213 ISSR (dpeaa)DE-He213 Genetic diversity (dpeaa)DE-He213 Molecular markers (dpeaa)DE-He213
topic	misc Grain amaranth misc spp. misc ISSR misc Genetic diversity misc Molecular markers
topic_unstemmed	misc Grain amaranth misc spp. misc ISSR misc Genetic diversity misc Molecular markers
topic_browse	misc Grain amaranth misc spp. misc ISSR misc Genetic diversity misc Molecular markers
format_facet	Elektronische Aufsätze Aufsätze Elektronische Ressource
format_main_str_mv	Text Zeitschrift/Artikel
carriertype_str_mv	cr
hierarchy_parent_title	Bulletin of the National Research Centre
hierarchy_parent_id	1035877007
hierarchy_top_title	Bulletin of the National Research Centre
isfreeaccess_txt	true
familylinks_str_mv	(DE-627)1035877007 (DE-600)2946659-3
title	Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers
ctrlnum	(DE-627)SPR038512920 (SPR)s42269-019-0146-2-e
title_full	Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers
author_sort	Gelotar, Mayuri J.
journal	Bulletin of the National Research Centre
journalStr	Bulletin of the National Research Centre
lang_code	eng
isOA_bool	true
recordtype	marc
publishDateSort	2019
contenttype_str_mv	txt
author_browse	Gelotar, Mayuri J. Dharajiya, Darshan T. Solanki, S. D. Prajapati, N. N. Tiwari, Kapil K.
container_volume	43
format_se	Elektronische Aufsätze
author-letter	Gelotar, Mayuri J.
doi_str_mv	10.1186/s42269-019-0146-2
normlink	(ORCID)0000-0001-5360-4631
normlink_prefix_str_mv	(orcid)0000-0001-5360-4631
title_sort	genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (issr) markers
title_auth	Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers
abstract	Background Grain amaranth (Amaranthus spp.) has been cultivated since ancient times in some countries in the world and it is one of the oldest food crops. At present, the crop has gained more importance in the plains of India, especially in parts of Gujarat and Maharashtra. Grain amaranth exhibits an incredible extent of morphological diversity and an extensive adaptability to diverse eco-geographical conditions. Hence, the aim of the recent research was to evaluate the genetic diversity of 19 genotypes from four diverse species of Amaranthus from India using ISSR markers. Results The set of 11 polymorphic ISSR primers produced a total of 114 amplicons, among which 98 amplicons were polymorphic. The mean number of polymorphic amplicons per primer was 8.91. Overall, the size of PCR-amplified DNA fragments ranged from 200 to 3702 bp. The average percent polymorphism was 87.15%, and the average PIC value was 0.853, which indicates good selection of primers in the present study for the assessment of genetic diversity. The unique amplicon (marker)-producing primers were also found which can be used for identification of genotypes. The dendrogram grouped 19 grain amaranth genotypes into two major clusters. The groups formed on the principle component analysis (PCA) plot resembles with the results of the dendrogram although some genotypes have been diverted on the PCA plot. Conclusions The technique may be used to obtain reasonably precise information on the genetic relationship among grain amaranth genotypes. Such information may be useful for selecting the diverse parents and monitoring the genetic diversity periodically in the breeder’s working collection of grain amaranth. © The Author(s) 2019
abstractGer	Background Grain amaranth (Amaranthus spp.) has been cultivated since ancient times in some countries in the world and it is one of the oldest food crops. At present, the crop has gained more importance in the plains of India, especially in parts of Gujarat and Maharashtra. Grain amaranth exhibits an incredible extent of morphological diversity and an extensive adaptability to diverse eco-geographical conditions. Hence, the aim of the recent research was to evaluate the genetic diversity of 19 genotypes from four diverse species of Amaranthus from India using ISSR markers. Results The set of 11 polymorphic ISSR primers produced a total of 114 amplicons, among which 98 amplicons were polymorphic. The mean number of polymorphic amplicons per primer was 8.91. Overall, the size of PCR-amplified DNA fragments ranged from 200 to 3702 bp. The average percent polymorphism was 87.15%, and the average PIC value was 0.853, which indicates good selection of primers in the present study for the assessment of genetic diversity. The unique amplicon (marker)-producing primers were also found which can be used for identification of genotypes. The dendrogram grouped 19 grain amaranth genotypes into two major clusters. The groups formed on the principle component analysis (PCA) plot resembles with the results of the dendrogram although some genotypes have been diverted on the PCA plot. Conclusions The technique may be used to obtain reasonably precise information on the genetic relationship among grain amaranth genotypes. Such information may be useful for selecting the diverse parents and monitoring the genetic diversity periodically in the breeder’s working collection of grain amaranth. © The Author(s) 2019
abstract_unstemmed	Background Grain amaranth (Amaranthus spp.) has been cultivated since ancient times in some countries in the world and it is one of the oldest food crops. At present, the crop has gained more importance in the plains of India, especially in parts of Gujarat and Maharashtra. Grain amaranth exhibits an incredible extent of morphological diversity and an extensive adaptability to diverse eco-geographical conditions. Hence, the aim of the recent research was to evaluate the genetic diversity of 19 genotypes from four diverse species of Amaranthus from India using ISSR markers. Results The set of 11 polymorphic ISSR primers produced a total of 114 amplicons, among which 98 amplicons were polymorphic. The mean number of polymorphic amplicons per primer was 8.91. Overall, the size of PCR-amplified DNA fragments ranged from 200 to 3702 bp. The average percent polymorphism was 87.15%, and the average PIC value was 0.853, which indicates good selection of primers in the present study for the assessment of genetic diversity. The unique amplicon (marker)-producing primers were also found which can be used for identification of genotypes. The dendrogram grouped 19 grain amaranth genotypes into two major clusters. The groups formed on the principle component analysis (PCA) plot resembles with the results of the dendrogram although some genotypes have been diverted on the PCA plot. Conclusions The technique may be used to obtain reasonably precise information on the genetic relationship among grain amaranth genotypes. Such information may be useful for selecting the diverse parents and monitoring the genetic diversity periodically in the breeder’s working collection of grain amaranth. © The Author(s) 2019
collection_details	GBV_USEFLAG_A SYSFLAG_A GBV_SPRINGER GBV_ILN_11 GBV_ILN_20 GBV_ILN_22 GBV_ILN_23 GBV_ILN_24 GBV_ILN_31 GBV_ILN_39 GBV_ILN_40 GBV_ILN_60 GBV_ILN_62 GBV_ILN_63 GBV_ILN_65 GBV_ILN_69 GBV_ILN_70 GBV_ILN_73 GBV_ILN_95 GBV_ILN_105 GBV_ILN_110 GBV_ILN_151 GBV_ILN_161 GBV_ILN_170 GBV_ILN_171 GBV_ILN_213 GBV_ILN_230 GBV_ILN_285 GBV_ILN_293 GBV_ILN_370 GBV_ILN_602 GBV_ILN_2005 GBV_ILN_2009 GBV_ILN_2014 GBV_ILN_2055 GBV_ILN_2111 GBV_ILN_4012 GBV_ILN_4037 GBV_ILN_4112 GBV_ILN_4125 GBV_ILN_4126 GBV_ILN_4249 GBV_ILN_4305 GBV_ILN_4306 GBV_ILN_4307 GBV_ILN_4313 GBV_ILN_4322 GBV_ILN_4323 GBV_ILN_4324 GBV_ILN_4325 GBV_ILN_4335 GBV_ILN_4338 GBV_ILN_4367 GBV_ILN_4700
container_issue	1
title_short	Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers
url	https://dx.doi.org/10.1186/s42269-019-0146-2
remote_bool	true
author2	Dharajiya, Darshan T. Solanki, S. D. Prajapati, N. N. Tiwari, Kapil K.
author2Str	Dharajiya, Darshan T. Solanki, S. D. Prajapati, N. N. Tiwari, Kapil K.
ppnlink	1035877007
mediatype_str_mv	c
isOA_txt	true
hochschulschrift_bool	false
doi_str	10.1186/s42269-019-0146-2
up_date	2024-07-03T18:35:43.962Z
_version_	1803584005967183872
fullrecord_marcxml	<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">SPR038512920</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230328214524.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">201007s2019 xx \|\|\|\|\|o 00\| \|\|eng c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1186/s42269-019-0146-2</subfield><subfield code="2">doi</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)SPR038512920</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(SPR)s42269-019-0146-2-e</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Gelotar, Mayuri J.</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2019</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">Text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">Computermedien</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">Online-Ressource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">© The Author(s) 2019</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Background Grain amaranth (Amaranthus spp.) has been cultivated since ancient times in some countries in the world and it is one of the oldest food crops. At present, the crop has gained more importance in the plains of India, especially in parts of Gujarat and Maharashtra. Grain amaranth exhibits an incredible extent of morphological diversity and an extensive adaptability to diverse eco-geographical conditions. Hence, the aim of the recent research was to evaluate the genetic diversity of 19 genotypes from four diverse species of Amaranthus from India using ISSR markers. Results The set of 11 polymorphic ISSR primers produced a total of 114 amplicons, among which 98 amplicons were polymorphic. The mean number of polymorphic amplicons per primer was 8.91. Overall, the size of PCR-amplified DNA fragments ranged from 200 to 3702 bp. The average percent polymorphism was 87.15%, and the average PIC value was 0.853, which indicates good selection of primers in the present study for the assessment of genetic diversity. The unique amplicon (marker)-producing primers were also found which can be used for identification of genotypes. The dendrogram grouped 19 grain amaranth genotypes into two major clusters. The groups formed on the principle component analysis (PCA) plot resembles with the results of the dendrogram although some genotypes have been diverted on the PCA plot. Conclusions The technique may be used to obtain reasonably precise information on the genetic relationship among grain amaranth genotypes. Such information may be useful for selecting the diverse parents and monitoring the genetic diversity periodically in the breeder’s working collection of grain amaranth.</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Grain amaranth</subfield><subfield code="7">(dpeaa)DE-He213</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">spp.</subfield><subfield code="7">(dpeaa)DE-He213</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">ISSR</subfield><subfield code="7">(dpeaa)DE-He213</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Genetic diversity</subfield><subfield code="7">(dpeaa)DE-He213</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Molecular markers</subfield><subfield code="7">(dpeaa)DE-He213</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Dharajiya, Darshan T.</subfield><subfield code="0">(orcid)0000-0001-5360-4631</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Solanki, S. D.</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Prajapati, N. N.</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Tiwari, Kapil K.</subfield><subfield code="4">aut</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">Enthalten in</subfield><subfield code="t">Bulletin of the National Research Centre</subfield><subfield code="d">Berlin : Springer, 2018</subfield><subfield code="g">43(2019), 1 vom: 26. Juni</subfield><subfield code="w">(DE-627)1035877007</subfield><subfield code="w">(DE-600)2946659-3</subfield><subfield code="x">2522-8307</subfield><subfield code="7">nnns</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:43</subfield><subfield code="g">year:2019</subfield><subfield code="g">number:1</subfield><subfield code="g">day:26</subfield><subfield code="g">month:06</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://dx.doi.org/10.1186/s42269-019-0146-2</subfield><subfield code="z">kostenfrei</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_A</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_SPRINGER</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_11</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_20</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_22</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_23</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_24</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_31</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_39</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_40</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_60</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_62</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_63</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_65</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_69</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_70</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_73</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_95</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_105</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_110</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_151</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_161</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_170</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_171</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_213</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_230</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_285</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_293</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_370</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_602</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2005</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2009</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2014</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2055</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_2111</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4012</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4037</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4112</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4125</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4126</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4249</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4305</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4306</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4307</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4313</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4322</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4323</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4324</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4325</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4335</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4338</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4367</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ILN_4700</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">43</subfield><subfield code="j">2019</subfield><subfield code="e">1</subfield><subfield code="b">26</subfield><subfield code="c">06</subfield></datafield></record></collection>
score	7.399907

Nicht das Richtige dabei?

Schreiben Sie uns!

Genetic diversity analysis and molecular characterization of grain amaranth genotypes using inter simple sequence repeat (ISSR) markers

Nicht das Richtige dabei?

Zugang & Verfügbarkeit

Vorhandene Bände

Nicht das Richtige dabei?