Brain serotonin 4 receptor binding is associated with the cortisol awakening response
• We performed a cross-sectional study to evaluate the association between brain serotonin 4 receptor binding and HPA-axis dynamics in healthy individuals. • We demonstrate a robust negative association between brain serotonin 4 receptor binding and the cortisol awakening response. • Our results rei...
Ausführliche Beschreibung
Gespeichert in:
| Autor*in: |
Jakobsen, Gustav R. [verfasserIn] |
|---|
| Format: |
E-Artikel |
|---|---|
| Sprache: |
Englisch |
| Erschienen: |
2016 |
|---|
| Schlagwörter: |
|---|
| Umfang: |
9 |
|---|
| Übergeordnetes Werk: |
Enthalten in: Crystal structure details of - Wang, Weiwei ELSEVIER, 2021, an international journal : the official journal of the International Society of Psychoneuroendocrinology, Amsterdam [u.a.] |
|---|---|
| Übergeordnetes Werk: |
volume:67 ; year:2016 ; pages:124-132 ; extent:9 |
| Links: |
|---|
| DOI / URN: |
10.1016/j.psyneuen.2016.01.032 |
|---|
| Katalog-ID: |
ELV019311060 |
|---|
| LEADER | 01000caa a22002652 4500 | ||
|---|---|---|---|
| 001 | ELV019311060 | ||
| 003 | DE-627 | ||
| 005 | 20230623150603.0 | ||
| 007 | cr uuu---uuuuu | ||
| 008 | 180603s2016 xx |||||o 00| ||eng c | ||
| 024 | 7 | |a 10.1016/j.psyneuen.2016.01.032 |2 doi | |
| 028 | 5 | 2 | |a GBVA2016009000015.pica |
| 035 | |a (DE-627)ELV019311060 | ||
| 035 | |a (ELSEVIER)S0306-4530(16)30030-0 | ||
| 040 | |a DE-627 |b ger |c DE-627 |e rakwb | ||
| 041 | |a eng | ||
| 082 | 0 | |a 610 | |
| 082 | 0 | 4 | |a 610 |q DE-600 |
| 082 | 0 | 4 | |a 540 |a 570 |q VZ |
| 084 | |a BIODIV |q DE-30 |2 fid | ||
| 084 | |a 35.80 |2 bkl | ||
| 084 | |a 58.30 |2 bkl | ||
| 100 | 1 | |a Jakobsen, Gustav R. |e verfasserin |4 aut | |
| 245 | 1 | 0 | |a Brain serotonin 4 receptor binding is associated with the cortisol awakening response |
| 264 | 1 | |c 2016 | |
| 300 | |a 9 | ||
| 336 | |a nicht spezifiziert |b zzz |2 rdacontent | ||
| 337 | |a nicht spezifiziert |b z |2 rdamedia | ||
| 338 | |a nicht spezifiziert |b zu |2 rdacarrier | ||
| 520 | |a • We performed a cross-sectional study to evaluate the association between brain serotonin 4 receptor binding and HPA-axis dynamics in healthy individuals. • We demonstrate a robust negative association between brain serotonin 4 receptor binding and the cortisol awakening response. • Our results reinforce an association between serotonin signalling and HPA-axis function in the human brain. • We suggest that serotonergic neurotransmission support HPA-axis dynamics in healthy individuals. | ||
| 650 | 7 | |a 5-HT4 |2 Elsevier | |
| 650 | 7 | |a Human |2 Elsevier | |
| 650 | 7 | |a Brain imaging |2 Elsevier | |
| 650 | 7 | |a Serotonin |2 Elsevier | |
| 650 | 7 | |a Neuroendocrinology |2 Elsevier | |
| 650 | 7 | |a Cortisol |2 Elsevier | |
| 650 | 7 | |a PET |2 Elsevier | |
| 650 | 7 | |a HPA-axis |2 Elsevier | |
| 700 | 1 | |a Fisher, Patrick M. |4 oth | |
| 700 | 1 | |a Dyssegaard, Agnete |4 oth | |
| 700 | 1 | |a McMahon, Brenda |4 oth | |
| 700 | 1 | |a Holst, Klaus K. |4 oth | |
| 700 | 1 | |a Lehel, Szabolcs |4 oth | |
| 700 | 1 | |a Svarer, Claus |4 oth | |
| 700 | 1 | |a Jensen, Peter S. |4 oth | |
| 700 | 1 | |a Knudsen, Gitte M. |4 oth | |
| 700 | 1 | |a Frokjaer, Vibe G. |4 oth | |
| 773 | 0 | 8 | |i Enthalten in |n Elsevier Science |a Wang, Weiwei ELSEVIER |t Crystal structure details of |d 2021 |d an international journal : the official journal of the International Society of Psychoneuroendocrinology |g Amsterdam [u.a.] |w (DE-627)ELV006269966 |
| 773 | 1 | 8 | |g volume:67 |g year:2016 |g pages:124-132 |g extent:9 |
| 856 | 4 | 0 | |u https://doi.org/10.1016/j.psyneuen.2016.01.032 |3 Volltext |
| 912 | |a GBV_USEFLAG_U | ||
| 912 | |a GBV_ELV | ||
| 912 | |a SYSFLAG_U | ||
| 912 | |a FID-BIODIV | ||
| 912 | |a SSG-OLC-PHA | ||
| 936 | b | k | |a 35.80 |j Makromolekulare Chemie |q VZ |
| 936 | b | k | |a 58.30 |j Biotechnologie |q VZ |
| 951 | |a AR | ||
| 952 | |d 67 |j 2016 |h 124-132 |g 9 | ||
| 953 | |2 045F |a 610 | ||
| author_variant |
g r j gr grj |
|---|---|
| matchkey_str |
jakobsengustavrfisherpatrickmdyssegaarda:2016----:risrtnnrcpobnigssoitdihhcri |
| hierarchy_sort_str |
2016 |
| bklnumber |
35.80 58.30 |
| publishDate |
2016 |
| allfields |
10.1016/j.psyneuen.2016.01.032 doi GBVA2016009000015.pica (DE-627)ELV019311060 (ELSEVIER)S0306-4530(16)30030-0 DE-627 ger DE-627 rakwb eng 610 610 DE-600 540 570 VZ BIODIV DE-30 fid 35.80 bkl 58.30 bkl Jakobsen, Gustav R. verfasserin aut Brain serotonin 4 receptor binding is associated with the cortisol awakening response 2016 9 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • We performed a cross-sectional study to evaluate the association between brain serotonin 4 receptor binding and HPA-axis dynamics in healthy individuals. • We demonstrate a robust negative association between brain serotonin 4 receptor binding and the cortisol awakening response. • Our results reinforce an association between serotonin signalling and HPA-axis function in the human brain. • We suggest that serotonergic neurotransmission support HPA-axis dynamics in healthy individuals. 5-HT4 Elsevier Human Elsevier Brain imaging Elsevier Serotonin Elsevier Neuroendocrinology Elsevier Cortisol Elsevier PET Elsevier HPA-axis Elsevier Fisher, Patrick M. oth Dyssegaard, Agnete oth McMahon, Brenda oth Holst, Klaus K. oth Lehel, Szabolcs oth Svarer, Claus oth Jensen, Peter S. oth Knudsen, Gitte M. oth Frokjaer, Vibe G. oth Enthalten in Elsevier Science Wang, Weiwei ELSEVIER Crystal structure details of 2021 an international journal : the official journal of the International Society of Psychoneuroendocrinology Amsterdam [u.a.] (DE-627)ELV006269966 volume:67 year:2016 pages:124-132 extent:9 https://doi.org/10.1016/j.psyneuen.2016.01.032 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U FID-BIODIV SSG-OLC-PHA 35.80 Makromolekulare Chemie VZ 58.30 Biotechnologie VZ AR 67 2016 124-132 9 045F 610 |
| spelling |
10.1016/j.psyneuen.2016.01.032 doi GBVA2016009000015.pica (DE-627)ELV019311060 (ELSEVIER)S0306-4530(16)30030-0 DE-627 ger DE-627 rakwb eng 610 610 DE-600 540 570 VZ BIODIV DE-30 fid 35.80 bkl 58.30 bkl Jakobsen, Gustav R. verfasserin aut Brain serotonin 4 receptor binding is associated with the cortisol awakening response 2016 9 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • We performed a cross-sectional study to evaluate the association between brain serotonin 4 receptor binding and HPA-axis dynamics in healthy individuals. • We demonstrate a robust negative association between brain serotonin 4 receptor binding and the cortisol awakening response. • Our results reinforce an association between serotonin signalling and HPA-axis function in the human brain. • We suggest that serotonergic neurotransmission support HPA-axis dynamics in healthy individuals. 5-HT4 Elsevier Human Elsevier Brain imaging Elsevier Serotonin Elsevier Neuroendocrinology Elsevier Cortisol Elsevier PET Elsevier HPA-axis Elsevier Fisher, Patrick M. oth Dyssegaard, Agnete oth McMahon, Brenda oth Holst, Klaus K. oth Lehel, Szabolcs oth Svarer, Claus oth Jensen, Peter S. oth Knudsen, Gitte M. oth Frokjaer, Vibe G. oth Enthalten in Elsevier Science Wang, Weiwei ELSEVIER Crystal structure details of 2021 an international journal : the official journal of the International Society of Psychoneuroendocrinology Amsterdam [u.a.] (DE-627)ELV006269966 volume:67 year:2016 pages:124-132 extent:9 https://doi.org/10.1016/j.psyneuen.2016.01.032 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U FID-BIODIV SSG-OLC-PHA 35.80 Makromolekulare Chemie VZ 58.30 Biotechnologie VZ AR 67 2016 124-132 9 045F 610 |
| allfields_unstemmed |
10.1016/j.psyneuen.2016.01.032 doi GBVA2016009000015.pica (DE-627)ELV019311060 (ELSEVIER)S0306-4530(16)30030-0 DE-627 ger DE-627 rakwb eng 610 610 DE-600 540 570 VZ BIODIV DE-30 fid 35.80 bkl 58.30 bkl Jakobsen, Gustav R. verfasserin aut Brain serotonin 4 receptor binding is associated with the cortisol awakening response 2016 9 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • We performed a cross-sectional study to evaluate the association between brain serotonin 4 receptor binding and HPA-axis dynamics in healthy individuals. • We demonstrate a robust negative association between brain serotonin 4 receptor binding and the cortisol awakening response. • Our results reinforce an association between serotonin signalling and HPA-axis function in the human brain. • We suggest that serotonergic neurotransmission support HPA-axis dynamics in healthy individuals. 5-HT4 Elsevier Human Elsevier Brain imaging Elsevier Serotonin Elsevier Neuroendocrinology Elsevier Cortisol Elsevier PET Elsevier HPA-axis Elsevier Fisher, Patrick M. oth Dyssegaard, Agnete oth McMahon, Brenda oth Holst, Klaus K. oth Lehel, Szabolcs oth Svarer, Claus oth Jensen, Peter S. oth Knudsen, Gitte M. oth Frokjaer, Vibe G. oth Enthalten in Elsevier Science Wang, Weiwei ELSEVIER Crystal structure details of 2021 an international journal : the official journal of the International Society of Psychoneuroendocrinology Amsterdam [u.a.] (DE-627)ELV006269966 volume:67 year:2016 pages:124-132 extent:9 https://doi.org/10.1016/j.psyneuen.2016.01.032 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U FID-BIODIV SSG-OLC-PHA 35.80 Makromolekulare Chemie VZ 58.30 Biotechnologie VZ AR 67 2016 124-132 9 045F 610 |
| allfieldsGer |
10.1016/j.psyneuen.2016.01.032 doi GBVA2016009000015.pica (DE-627)ELV019311060 (ELSEVIER)S0306-4530(16)30030-0 DE-627 ger DE-627 rakwb eng 610 610 DE-600 540 570 VZ BIODIV DE-30 fid 35.80 bkl 58.30 bkl Jakobsen, Gustav R. verfasserin aut Brain serotonin 4 receptor binding is associated with the cortisol awakening response 2016 9 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • We performed a cross-sectional study to evaluate the association between brain serotonin 4 receptor binding and HPA-axis dynamics in healthy individuals. • We demonstrate a robust negative association between brain serotonin 4 receptor binding and the cortisol awakening response. • Our results reinforce an association between serotonin signalling and HPA-axis function in the human brain. • We suggest that serotonergic neurotransmission support HPA-axis dynamics in healthy individuals. 5-HT4 Elsevier Human Elsevier Brain imaging Elsevier Serotonin Elsevier Neuroendocrinology Elsevier Cortisol Elsevier PET Elsevier HPA-axis Elsevier Fisher, Patrick M. oth Dyssegaard, Agnete oth McMahon, Brenda oth Holst, Klaus K. oth Lehel, Szabolcs oth Svarer, Claus oth Jensen, Peter S. oth Knudsen, Gitte M. oth Frokjaer, Vibe G. oth Enthalten in Elsevier Science Wang, Weiwei ELSEVIER Crystal structure details of 2021 an international journal : the official journal of the International Society of Psychoneuroendocrinology Amsterdam [u.a.] (DE-627)ELV006269966 volume:67 year:2016 pages:124-132 extent:9 https://doi.org/10.1016/j.psyneuen.2016.01.032 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U FID-BIODIV SSG-OLC-PHA 35.80 Makromolekulare Chemie VZ 58.30 Biotechnologie VZ AR 67 2016 124-132 9 045F 610 |
| allfieldsSound |
10.1016/j.psyneuen.2016.01.032 doi GBVA2016009000015.pica (DE-627)ELV019311060 (ELSEVIER)S0306-4530(16)30030-0 DE-627 ger DE-627 rakwb eng 610 610 DE-600 540 570 VZ BIODIV DE-30 fid 35.80 bkl 58.30 bkl Jakobsen, Gustav R. verfasserin aut Brain serotonin 4 receptor binding is associated with the cortisol awakening response 2016 9 nicht spezifiziert zzz rdacontent nicht spezifiziert z rdamedia nicht spezifiziert zu rdacarrier • We performed a cross-sectional study to evaluate the association between brain serotonin 4 receptor binding and HPA-axis dynamics in healthy individuals. • We demonstrate a robust negative association between brain serotonin 4 receptor binding and the cortisol awakening response. • Our results reinforce an association between serotonin signalling and HPA-axis function in the human brain. • We suggest that serotonergic neurotransmission support HPA-axis dynamics in healthy individuals. 5-HT4 Elsevier Human Elsevier Brain imaging Elsevier Serotonin Elsevier Neuroendocrinology Elsevier Cortisol Elsevier PET Elsevier HPA-axis Elsevier Fisher, Patrick M. oth Dyssegaard, Agnete oth McMahon, Brenda oth Holst, Klaus K. oth Lehel, Szabolcs oth Svarer, Claus oth Jensen, Peter S. oth Knudsen, Gitte M. oth Frokjaer, Vibe G. oth Enthalten in Elsevier Science Wang, Weiwei ELSEVIER Crystal structure details of 2021 an international journal : the official journal of the International Society of Psychoneuroendocrinology Amsterdam [u.a.] (DE-627)ELV006269966 volume:67 year:2016 pages:124-132 extent:9 https://doi.org/10.1016/j.psyneuen.2016.01.032 Volltext GBV_USEFLAG_U GBV_ELV SYSFLAG_U FID-BIODIV SSG-OLC-PHA 35.80 Makromolekulare Chemie VZ 58.30 Biotechnologie VZ AR 67 2016 124-132 9 045F 610 |
| language |
English |
| source |
Enthalten in Crystal structure details of Amsterdam [u.a.] volume:67 year:2016 pages:124-132 extent:9 |
| sourceStr |
Enthalten in Crystal structure details of Amsterdam [u.a.] volume:67 year:2016 pages:124-132 extent:9 |
| format_phy_str_mv |
Article |
| bklname |
Makromolekulare Chemie Biotechnologie |
| institution |
findex.gbv.de |
| topic_facet |
5-HT4 Human Brain imaging Serotonin Neuroendocrinology Cortisol PET HPA-axis |
| dewey-raw |
610 |
| isfreeaccess_bool |
false |
| container_title |
Crystal structure details of |
| authorswithroles_txt_mv |
Jakobsen, Gustav R. @@aut@@ Fisher, Patrick M. @@oth@@ Dyssegaard, Agnete @@oth@@ McMahon, Brenda @@oth@@ Holst, Klaus K. @@oth@@ Lehel, Szabolcs @@oth@@ Svarer, Claus @@oth@@ Jensen, Peter S. @@oth@@ Knudsen, Gitte M. @@oth@@ Frokjaer, Vibe G. @@oth@@ |
| publishDateDaySort_date |
2016-01-01T00:00:00Z |
| hierarchy_top_id |
ELV006269966 |
| dewey-sort |
3610 |
| id |
ELV019311060 |
| language_de |
englisch |
| fullrecord |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">ELV019311060</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230623150603.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">180603s2016 xx |||||o 00| ||eng c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1016/j.psyneuen.2016.01.032</subfield><subfield code="2">doi</subfield></datafield><datafield tag="028" ind1="5" ind2="2"><subfield code="a">GBVA2016009000015.pica</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)ELV019311060</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ELSEVIER)S0306-4530(16)30030-0</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">610</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">610</subfield><subfield code="q">DE-600</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">540</subfield><subfield code="a">570</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">BIODIV</subfield><subfield code="q">DE-30</subfield><subfield code="2">fid</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">35.80</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">58.30</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Jakobsen, Gustav R.</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Brain serotonin 4 receptor binding is associated with the cortisol awakening response</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2016</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">9</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zzz</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">z</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zu</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">• We performed a cross-sectional study to evaluate the association between brain serotonin 4 receptor binding and HPA-axis dynamics in healthy individuals. • We demonstrate a robust negative association between brain serotonin 4 receptor binding and the cortisol awakening response. • Our results reinforce an association between serotonin signalling and HPA-axis function in the human brain. • We suggest that serotonergic neurotransmission support HPA-axis dynamics in healthy individuals.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">5-HT4</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Human</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Brain imaging</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Serotonin</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Neuroendocrinology</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Cortisol</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">PET</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">HPA-axis</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Fisher, Patrick M.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Dyssegaard, Agnete</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">McMahon, Brenda</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Holst, Klaus K.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Lehel, Szabolcs</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Svarer, Claus</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Jensen, Peter S.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Knudsen, Gitte M.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Frokjaer, Vibe G.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">Enthalten in</subfield><subfield code="n">Elsevier Science</subfield><subfield code="a">Wang, Weiwei ELSEVIER</subfield><subfield code="t">Crystal structure details of</subfield><subfield code="d">2021</subfield><subfield code="d">an international journal : the official journal of the International Society of Psychoneuroendocrinology</subfield><subfield code="g">Amsterdam [u.a.]</subfield><subfield code="w">(DE-627)ELV006269966</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:67</subfield><subfield code="g">year:2016</subfield><subfield code="g">pages:124-132</subfield><subfield code="g">extent:9</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.1016/j.psyneuen.2016.01.032</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ELV</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">FID-BIODIV</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SSG-OLC-PHA</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">35.80</subfield><subfield code="j">Makromolekulare Chemie</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">58.30</subfield><subfield code="j">Biotechnologie</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">67</subfield><subfield code="j">2016</subfield><subfield code="h">124-132</subfield><subfield code="g">9</subfield></datafield><datafield tag="953" ind1=" " ind2=" "><subfield code="2">045F</subfield><subfield code="a">610</subfield></datafield></record></collection>
|
| author |
Jakobsen, Gustav R. |
| spellingShingle |
Jakobsen, Gustav R. ddc 610 ddc 540 fid BIODIV bkl 35.80 bkl 58.30 Elsevier 5-HT4 Elsevier Human Elsevier Brain imaging Elsevier Serotonin Elsevier Neuroendocrinology Elsevier Cortisol Elsevier PET Elsevier HPA-axis Brain serotonin 4 receptor binding is associated with the cortisol awakening response |
| authorStr |
Jakobsen, Gustav R. |
| ppnlink_with_tag_str_mv |
@@773@@(DE-627)ELV006269966 |
| format |
electronic Article |
| dewey-ones |
610 - Medicine & health 540 - Chemistry & allied sciences 570 - Life sciences; biology |
| delete_txt_mv |
keep |
| author_role |
aut |
| collection |
elsevier |
| remote_str |
true |
| illustrated |
Not Illustrated |
| topic_title |
610 610 DE-600 540 570 VZ BIODIV DE-30 fid 35.80 bkl 58.30 bkl Brain serotonin 4 receptor binding is associated with the cortisol awakening response 5-HT4 Elsevier Human Elsevier Brain imaging Elsevier Serotonin Elsevier Neuroendocrinology Elsevier Cortisol Elsevier PET Elsevier HPA-axis Elsevier |
| topic |
ddc 610 ddc 540 fid BIODIV bkl 35.80 bkl 58.30 Elsevier 5-HT4 Elsevier Human Elsevier Brain imaging Elsevier Serotonin Elsevier Neuroendocrinology Elsevier Cortisol Elsevier PET Elsevier HPA-axis |
| topic_unstemmed |
ddc 610 ddc 540 fid BIODIV bkl 35.80 bkl 58.30 Elsevier 5-HT4 Elsevier Human Elsevier Brain imaging Elsevier Serotonin Elsevier Neuroendocrinology Elsevier Cortisol Elsevier PET Elsevier HPA-axis |
| topic_browse |
ddc 610 ddc 540 fid BIODIV bkl 35.80 bkl 58.30 Elsevier 5-HT4 Elsevier Human Elsevier Brain imaging Elsevier Serotonin Elsevier Neuroendocrinology Elsevier Cortisol Elsevier PET Elsevier HPA-axis |
| format_facet |
Elektronische Aufsätze Aufsätze Elektronische Ressource |
| format_main_str_mv |
Text Zeitschrift/Artikel |
| carriertype_str_mv |
zu |
| author2_variant |
p m f pm pmf a d ad b m bm k k h kk kkh s l sl c s cs p s j ps psj g m k gm gmk v g f vg vgf |
| hierarchy_parent_title |
Crystal structure details of |
| hierarchy_parent_id |
ELV006269966 |
| dewey-tens |
610 - Medicine & health 540 - Chemistry 570 - Life sciences; biology |
| hierarchy_top_title |
Crystal structure details of |
| isfreeaccess_txt |
false |
| familylinks_str_mv |
(DE-627)ELV006269966 |
| title |
Brain serotonin 4 receptor binding is associated with the cortisol awakening response |
| ctrlnum |
(DE-627)ELV019311060 (ELSEVIER)S0306-4530(16)30030-0 |
| title_full |
Brain serotonin 4 receptor binding is associated with the cortisol awakening response |
| author_sort |
Jakobsen, Gustav R. |
| journal |
Crystal structure details of |
| journalStr |
Crystal structure details of |
| lang_code |
eng |
| isOA_bool |
false |
| dewey-hundreds |
600 - Technology 500 - Science |
| recordtype |
marc |
| publishDateSort |
2016 |
| contenttype_str_mv |
zzz |
| container_start_page |
124 |
| author_browse |
Jakobsen, Gustav R. |
| container_volume |
67 |
| physical |
9 |
| class |
610 610 DE-600 540 570 VZ BIODIV DE-30 fid 35.80 bkl 58.30 bkl |
| format_se |
Elektronische Aufsätze |
| author-letter |
Jakobsen, Gustav R. |
| doi_str_mv |
10.1016/j.psyneuen.2016.01.032 |
| dewey-full |
610 540 570 |
| title_sort |
brain serotonin 4 receptor binding is associated with the cortisol awakening response |
| title_auth |
Brain serotonin 4 receptor binding is associated with the cortisol awakening response |
| abstract |
• We performed a cross-sectional study to evaluate the association between brain serotonin 4 receptor binding and HPA-axis dynamics in healthy individuals. • We demonstrate a robust negative association between brain serotonin 4 receptor binding and the cortisol awakening response. • Our results reinforce an association between serotonin signalling and HPA-axis function in the human brain. • We suggest that serotonergic neurotransmission support HPA-axis dynamics in healthy individuals. |
| abstractGer |
• We performed a cross-sectional study to evaluate the association between brain serotonin 4 receptor binding and HPA-axis dynamics in healthy individuals. • We demonstrate a robust negative association between brain serotonin 4 receptor binding and the cortisol awakening response. • Our results reinforce an association between serotonin signalling and HPA-axis function in the human brain. • We suggest that serotonergic neurotransmission support HPA-axis dynamics in healthy individuals. |
| abstract_unstemmed |
• We performed a cross-sectional study to evaluate the association between brain serotonin 4 receptor binding and HPA-axis dynamics in healthy individuals. • We demonstrate a robust negative association between brain serotonin 4 receptor binding and the cortisol awakening response. • Our results reinforce an association between serotonin signalling and HPA-axis function in the human brain. • We suggest that serotonergic neurotransmission support HPA-axis dynamics in healthy individuals. |
| collection_details |
GBV_USEFLAG_U GBV_ELV SYSFLAG_U FID-BIODIV SSG-OLC-PHA |
| title_short |
Brain serotonin 4 receptor binding is associated with the cortisol awakening response |
| url |
https://doi.org/10.1016/j.psyneuen.2016.01.032 |
| remote_bool |
true |
| author2 |
Fisher, Patrick M. Dyssegaard, Agnete McMahon, Brenda Holst, Klaus K. Lehel, Szabolcs Svarer, Claus Jensen, Peter S. Knudsen, Gitte M. Frokjaer, Vibe G. |
| author2Str |
Fisher, Patrick M. Dyssegaard, Agnete McMahon, Brenda Holst, Klaus K. Lehel, Szabolcs Svarer, Claus Jensen, Peter S. Knudsen, Gitte M. Frokjaer, Vibe G. |
| ppnlink |
ELV006269966 |
| mediatype_str_mv |
z |
| isOA_txt |
false |
| hochschulschrift_bool |
false |
| author2_role |
oth oth oth oth oth oth oth oth oth |
| doi_str |
10.1016/j.psyneuen.2016.01.032 |
| up_date |
2024-07-06T21:07:00.548Z |
| _version_ |
1803865314347188224 |
| fullrecord_marcxml |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01000caa a22002652 4500</leader><controlfield tag="001">ELV019311060</controlfield><controlfield tag="003">DE-627</controlfield><controlfield tag="005">20230623150603.0</controlfield><controlfield tag="007">cr uuu---uuuuu</controlfield><controlfield tag="008">180603s2016 xx |||||o 00| ||eng c</controlfield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1016/j.psyneuen.2016.01.032</subfield><subfield code="2">doi</subfield></datafield><datafield tag="028" ind1="5" ind2="2"><subfield code="a">GBVA2016009000015.pica</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-627)ELV019311060</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ELSEVIER)S0306-4530(16)30030-0</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-627</subfield><subfield code="b">ger</subfield><subfield code="c">DE-627</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">610</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">610</subfield><subfield code="q">DE-600</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">540</subfield><subfield code="a">570</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">BIODIV</subfield><subfield code="q">DE-30</subfield><subfield code="2">fid</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">35.80</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">58.30</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Jakobsen, Gustav R.</subfield><subfield code="e">verfasserin</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Brain serotonin 4 receptor binding is associated with the cortisol awakening response</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="c">2016</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">9</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zzz</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">z</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">nicht spezifiziert</subfield><subfield code="b">zu</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">• We performed a cross-sectional study to evaluate the association between brain serotonin 4 receptor binding and HPA-axis dynamics in healthy individuals. • We demonstrate a robust negative association between brain serotonin 4 receptor binding and the cortisol awakening response. • Our results reinforce an association between serotonin signalling and HPA-axis function in the human brain. • We suggest that serotonergic neurotransmission support HPA-axis dynamics in healthy individuals.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">5-HT4</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Human</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Brain imaging</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Serotonin</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Neuroendocrinology</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Cortisol</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">PET</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">HPA-axis</subfield><subfield code="2">Elsevier</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Fisher, Patrick M.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Dyssegaard, Agnete</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">McMahon, Brenda</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Holst, Klaus K.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Lehel, Szabolcs</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Svarer, Claus</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Jensen, Peter S.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Knudsen, Gitte M.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Frokjaer, Vibe G.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="773" ind1="0" ind2="8"><subfield code="i">Enthalten in</subfield><subfield code="n">Elsevier Science</subfield><subfield code="a">Wang, Weiwei ELSEVIER</subfield><subfield code="t">Crystal structure details of</subfield><subfield code="d">2021</subfield><subfield code="d">an international journal : the official journal of the International Society of Psychoneuroendocrinology</subfield><subfield code="g">Amsterdam [u.a.]</subfield><subfield code="w">(DE-627)ELV006269966</subfield></datafield><datafield tag="773" ind1="1" ind2="8"><subfield code="g">volume:67</subfield><subfield code="g">year:2016</subfield><subfield code="g">pages:124-132</subfield><subfield code="g">extent:9</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.1016/j.psyneuen.2016.01.032</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_USEFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">GBV_ELV</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SYSFLAG_U</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">FID-BIODIV</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">SSG-OLC-PHA</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">35.80</subfield><subfield code="j">Makromolekulare Chemie</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="936" ind1="b" ind2="k"><subfield code="a">58.30</subfield><subfield code="j">Biotechnologie</subfield><subfield code="q">VZ</subfield></datafield><datafield tag="951" ind1=" " ind2=" "><subfield code="a">AR</subfield></datafield><datafield tag="952" ind1=" " ind2=" "><subfield code="d">67</subfield><subfield code="j">2016</subfield><subfield code="h">124-132</subfield><subfield code="g">9</subfield></datafield><datafield tag="953" ind1=" " ind2=" "><subfield code="2">045F</subfield><subfield code="a">610</subfield></datafield></record></collection>
|
| score |
7.4020147 |